Labshake search
Citations for New England Biolabs :
2151 - 2200 of 2232 citations for Rat BRSK1 shRNA Plasmid since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2022Quote: ... The pACYC184::attI1 recipient plasmid was created by assembling the attI1 sequence (from R388) into the pACYC184 plasmid backbone using the NEBuilder HiFi DNA Assembly Cloning Kit (New England Biolabs, United States). The PCR products required for the assembly were generated using the attI1_fw/attI1_rev and pACYC184_backbone_F/pACYC184_backbone_R primer pairs ...
-
bioRxiv - Genetics 2022Quote: ... the truncated versions of cwr-1 and the histidine mutant plasmids were prepared using the Q5 Site-Directed Mutagenesis Kit (E0552S NEB, Ipswich, MA). Gibson assembly (E2611S NEB ...
-
bioRxiv - Microbiology 2021Quote: ... resulting in ∼1 ml of turbid bacterial culture which was subsequently used as input for plasmid purification by miniprep kit (New England Biolabs, cat#T1010S). The pooled plasmid library DNA for each library was eluted in 35 μl of elution buffer and quantified ...
-
bioRxiv - Microbiology 2020Quote: ... and PCR products were digested with DpnI to eliminate plasmid template before setting up the assembly reaction (New England BioLabs, MA, USA). Finally ...
-
bioRxiv - Microbiology 2022Quote: ... All capped viral RNA was in vitro transcribed from the corresponding linearized plasmid using the HiScribe T7 antireverse cap analog (ARCA) mRNA kit (New England Biolabs, Ipswich, MA) according to the manufacturer’s protocol ...
-
bioRxiv - Genomics 2022Quote: ... the plasmid library was linearized by BsmbI digestion and ligated with TmU fragments with Quick ligation™ kit (New England BioLabs, M2200S) for 5 minutes at room temperature ...
-
bioRxiv - Biophysics 2019Quote: ... DKFPVAENPSSHPWTSASGSGSGTAEGGSTAGSVVPSTQPVTTPPATTKPPATTIPPSDDPNA And an extended version of ∼ 44 nm contour length: DKFPVAENPSSGGGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSGGGSGGGSEGGG SEGGGSEGGGSEGGGSEGGGSGGGSESTAGSVVPSTQPVTTPPATTKPPATTIPPSDDPNA All plasmids were assembled using the Gibson assembly strategy40 (New England Biolabs, MA, USA) into pET28a Vectors ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid encoding GFP-labeled dominant negative mutant version of human Rab5B isoform was introduced to plasmid #1008 using Q5 Site-Directed Mutagenisis kit (NEB, Cat# E0554S) according to manufacturer’s instructions using forward primer #1554 (AGTGGGAAAGaacAGCCTGGTATTAC ...
-
bioRxiv - Microbiology 2020Quote: ... polymerases and Gibson assembly mix reagents were used to manipulate DNA fragments and plasmids according to manufacturer instructions (New England Biolabs and Promega).
-
bioRxiv - Microbiology 2020Quote: ... pCrPV-1A-DcDV was linearized by inverse PCR with primers 17 and 18 and the linearized plasmid was circularized by blunt end ligation with T4 DNA ligase (New England Biolabs, Ipswich, Massachusetts) according to the manufacturer’s instructions to create pCrPV-1A-DcDV-1A ...
-
bioRxiv - Microbiology 2019Quote: ... The AmgK MurU amplification product and plasmid pLC292 (Terry et al., 2005) were digested with BamHI-HF and HindIII-HF (New England BioLabs, Ipswich, MA) at 37°C for 1 hour and cleaned up with the QIAquick PCR Purification Kit (Qiagen ...
-
bioRxiv - Cell Biology 2020Quote: The myo-3p::EFF-1 plasmid was constructed by cloning the myo-3 promoter region from myo-3p::mCherry plasmid with Sal I (New England BioLabs Cat#R3138) and Nhe I (ThermoFisher Cat# FD0974 ...
-
bioRxiv - Biochemistry 2019Quote: ... and BchB were PCR amplified from Rhodobacter sphaeroides genomic DNA and cloned into pRSF-Duet 1 or pET-Duet 1 plasmids as described.12 Mutations in BchL were generated using Q5 site-directed mutagenesis (New England Biolabs, Ipswich, MA). Plasmids used to express the linked-BchL-proteins carrying glycine linkers of various lengths were synthesized as codon-optimized genes (Genscript Inc. ...
-
bioRxiv - Developmental Biology 2021Quote: ... A restriction digest was performed on a tol2-hsp70 plasmid (Row et al., 2016) using the restriction enzymes BamHI-HF and ClaI (NEB bio labs). PCR amplification of plasmid hCCR4 (lifeact-mScarlet ...
-
bioRxiv - Microbiology 2021Quote: ... The amplicon was cloned into the pTXTL-T7p14-aH plasmid (replacing alpha hemolysin, Daicel Arbor Biosciences, Ann-Arbor, MI) using NcoI-HF and SmaI (New England Biolabs, Ipswitch, MA). The new plasmid construct (pSLP15 ...
-
bioRxiv - Microbiology 2020Quote: ... The H373A point mutation was introduced into pBAD plasmids carrying NGO1686 derivatives via Q5 site-directed mutagenesis (NEB, Ipswitch, MA, cat #E0554S) with primer pair TDP1652/TDP1653 ...
-
bioRxiv - Immunology 2021Quote: ... The final lentiviral transfer plasmids were assembled using the NEB® Golden Gate Assembly Kit (BsmBI-v2, New England Biolabs cat E1602L).
-
bioRxiv - Bioengineering 2022Quote: All Golden Gate Assembly reactions started with 1 µg of the constructed plasmid (pIS001, pIS002, or pIS003) and BsaI-HFv2 (20 or 60 U from 20 U/µL) (NEB; catalog # R3733L), 400 U of T4 DNA ligase (1 µL of 400 U/µL ...
-
bioRxiv - Immunology 2022Quote: ... Delta and BA.2 spike plasmids were linearized by restriction enzymes and transcribed to mRNA by in vitro T7 RNA polymerase (NEB, Cat # E2060S) as previously described10.
-
bioRxiv - Plant Biology 2022Quote: ... The 6-His-TRX construct was obtained after digesting the pET-trx1a plasmid with the NcoI and XhoI restriction endonucleases (New England Biolabs, Hitchin, UK), removing the cDNA insert corresponding to the GFP coding sequence ...
-
bioRxiv - Microbiology 2022Quote: ... The primers were designed with 25 bp of overlapping sequence for isothermal assembly (40) into pNPTS139 plasmid digested using EcoRV-HF (New England Biolabs, Ispswich, MA) using the NEBuilder HiFi Assembly Master mix (NEB) ...
-
bioRxiv - Synthetic Biology 2022Quote: ... plasmid (Monarch® PCR mini-prep kit) and gel extraction kits (Monarch® DNA gel extraction kit) were also obtained from NEB and used according to the manufacturer’s protocols ...
-
bioRxiv - Molecular Biology 2023Quote: ... The digested T/F LTR U3R region was cloned into the linearized pGL3 Basic vector/plasmid and ligated using 1 U of T4 DNA ligase (New England Biolabs, MA, USA) as per manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2022Quote: ... Strains with chromosomal insertions were constructed by amplifying overexpression cassettes from previously constructed plasmids with Phusion polymerase (New England Biolabs, Evry, France) and oligonucleotides eo-chrXI-f and eo-chrXI-r (Supplementary materials) ...
-
bioRxiv - Neuroscience 2023Quote: ... TRIM71-R608H expression plasmid was generated by cloning DNA fragment-R608H (Integrated DNA Technology) (table S5) into pCDH-EF1a-3xHA-TRIM71-T2A-mCherry plasmid using SmaI (NEB, no. R0141) and EcoRI-HF (NEB ...
-
bioRxiv - Synthetic Biology 2023Quote: ... the 700 base pair genomic region directly upstream from the target gene’s start codon and the 700 base pair genomic region directly downstream from the target gene’s stop codon were cloned in tandem into the pKOS6b plasmid cut with XbaI using Gibson assembly43 (E2611, New England Biolabs, Ipswich, MA). For insertion of promoter regions ...
-
bioRxiv - Microbiology 2023Quote: ... and used as “megaprimers” that are denatured and annealed to the original plasmid (pNG93) to amplify the vector backbone using Q5® High-Fidelity 2X Master Mix (NEB, M0492S). The reactions were then digested with DpnI to eliminate any remaining parental plasmid DNA ...
-
bioRxiv - Genetics 2023Quote: ... were assembled in the pCFJ150 vector to create the pCT3.37 plasmid (NEBuilder® HiFi DNA Assembly Cloning Kit, New England BioLabs, cat#E5520). The protocol previously described for the generation of mosSCI transgenic lines (Frøkjær-Jensen et al. ...
-
bioRxiv - Biochemistry 2023Quote: ... These plasmids were constructed using the NEBuilder HiFi DNA assembly master mix as per the supplier’s recommendation (New England Biolabs GmbH, Frankfurt, Germany). The pLH52 and pLH53 plasmids were a gift from Dr ...
-
bioRxiv - Biophysics 2023Quote: ... This plasmid was used as a template for G2019S and I2020T site-directed mutagenesis (Q5 Site-Directed Mutagenesis Kit, NEB, Catalog # E0445S). These plasmids were used for the generation of recombinant baculoviruses following Bac-to-Bac expression system protocols (Invitrogen ...
-
bioRxiv - Molecular Biology 2023Quote: ... viral RNA was produced via in vitro transcription of an XbaI-linearized HCV-Jc1 or AflII-linearized YFV-17D plasmid using the HiScribe® T7 High Yield RNA Synthesis Kit (HCV, New England Biolabs E2040S) or mMESSAGE mMACHINE™ SP6 Transcription Kit (YFV-17D ...
-
bioRxiv - Molecular Biology 2023Quote: ... We then ordered additional DNA oligos and introduced lox66 sites downstream of the FRT sites of the resulting NcoI-HF®- and NotI-HF®-digested plasmids (both NEB). For the plasmid containing an FRT site ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Assembly of the final CRISPRi plasmid was done by combining the libraries of the gRNA position vectors with the pST_301 plasmid in a Golde Gate reaction as described above but with Esp3I (NEB, 10,000 U/mL) instead of BsaI ...
-
bioRxiv - Molecular Biology 2024Quote: ... Isolated plasmids were prepared for transformation by linearizing with EcoRI restriction enzyme according to the supplier’s instructions (NEB, Ipswich, MA, The US).
-
bioRxiv - Microbiology 2024Quote: ... and assembled in frame into the digested pLIC-HA -DHFR-TS plasmid in frame with the 3x HA tag using the NEBuilder HiFi DNA Assembly cloning Kit (NEB, cat# E5520) according to the manufacturer’s instructions ...
-
bioRxiv - Bioengineering 2024Quote: Linear dsDNA templates were made via PCR amplification was done using the GD2-CAR or no CAR Control plasmid as a template using Q5 Hot Start Polymerase (Cat # M0494S, NEB, Ipswich, MA) in 50 uL reaction volumes ...
-
bioRxiv - Biophysics 2024Quote: ... Microexon 4 sequence (nucleotides 1258-1281) was deleted by PCR on the pBSK-nCPEB4 plasmid using Gibson Assembly® Master Mix (New England Biolabs, E2611S), following the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2020Quote: ... The coding sequence for Dendra2 was amplified from a plasmid clone and inserted into this backbone using the Gibson Assembly® Cloning Kit (New England Biolabs, Frankfurt, Germany); the primer sequences are available upon request ...
-
bioRxiv - Genomics 2022Quote: ... 10 μg of Δorf library plasmid was digested with 100 units of AsiSI for vector A or PmeI for vector P (NEB, R0630 or R0560) at 37°C overnight ...
-
bioRxiv - Immunology 2021Quote: ... mRNA was generated from the T7 promoter in the linearized plasmids with the HiScribe T7 ARCA mRNA kit with tailing (NEB #E2060S, Ipswich, MA). We would typically use half of a kit (10 reactions ...
-
bioRxiv - Molecular Biology 2021Quote: ... These two DNA fragments were combined with BamHI digested pFA6a-natNT2 plasmid using NEBuilder HiFi DNA Assembly Master Mix (E2621, New England Biolabs, Ipswich, MA, USA). The resulting plasmid (pHM1119 ...
-
bioRxiv - Molecular Biology 2020Quote: ... The Npac mutant plasmid was generated according to the manual of Q5® Site-Directed Mutagenesis Kit (E0554S, New England Biolabs. Ipswich, MA). The plasmid of full-length Npac cDNA inserted in pCAG-Neo vector was used as PCR template ...
-
bioRxiv - Cell Biology 2019Quote: ... Sticky-ΔminiCC2a-L1246N was generated by first digesting Sticky-L1246N-pENTR and Sticky-ΔminiCC2a-pMT plasmids with MfeI and BsaAI restriction enzymes (New England Biolabs, #R0589 and #R0531) for 2 hours at 37°C followed by treatment of the Sticky-L1246N-pENTR backbone with 1 µl of calf alkaline phosphatase for 30 minutes at 37°C and gel extraction and purification of digested plasmids ...
-
bioRxiv - Bioengineering 2020Quote: ... 1kb homology arms were synthesized by GeneWiz containing regions flanking the cut site (South Plainfield, NJ) and inserted into the donor plasmids using Gibson Assembly Master Mix (New England Biolabs, Inc., Ipswich, MA), with (hmejSRYp ...
-
bioRxiv - Cell Biology 2021Quote: ... Amplicons and pCineo plasmid (linearized by NheI/EcoRI digestion) were assembled using the NEBuilder HiFi DNA assembly cloning kit (New England Biolabs, cat. no. E5520), following the manufacturer instructions ...
-
bioRxiv - Immunology 2021Quote: Restriction digest of pEX-K4 plasmid DNA containing EtAMA1Cit or was performed using Bam HI and Xho I (New England Biolabs, Ipswich, MA, USA) to extract tagged antigen coding sequences for cloning into pYD1 plasmid vector ...
-
bioRxiv - Plant Biology 2021Quote: ... The purified PCR products and the pLSU-1.1 plasmid were digested with KpnI-HF® and BamHI-HF® (New England Biolabs® Inc.). With the same restriction enzymes ...
-
bioRxiv - Synthetic Biology 2021Quote: ... the pKDsg-ack plasmid was amplified with primers pKD1 and IS1noScarFwd as well as pKD2 + IS1noScarRev using Q5 DNA polymerase (New England Biolabs, Ipswitch, MA, USA). Both products were DpnI digested and cleaned with the Viogene Gel/PCR DNA Isolation Kit (Viogene-Biotek Corporation ...
-
bioRxiv - Microbiology 2019Quote: ... Plasmids were amplified with the primer pair F5: CAACAAGCTAGCGTTTGCGAGGCTAAAGGCG / F6: CAACAATCTAGAGGTTCCCACTCCCAAAGC and DNA sequences digested with XbaI and BmtI (NEB, Ipswitch, MA, USA) and ligated ...
-
bioRxiv - Biophysics 2020Quote: ... The 20-helix bundle with hexagonal lattice is based on the M13mp18 7429-nucleotide long scaffold plasmid (p7429) (Bayou Biolabs, Metairie, LA, USA), and was modified using CaDNAno49 ...