Labshake search
Citations for Addgene :
401 - 450 of 10000+ citations since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2024Quote: ... The following AAV vectors were purchased from Addgene: AAV5-hSyn-DIO-hM3D(Gq)-mCherry (#44361) ...
-
bioRxiv - Neuroscience 2024Quote: ... Olig001 was a gift from Thomas McCown (Addgene plasmid # 170716; http://n2t.net/addgene:170716; RRID:Addgene_170716)79.
-
bioRxiv - Neuroscience 2024Quote: ... pAAV.CAG.GCaMP6f.WPRE.SV40 was a gift from Douglas Kim & GENIE Project (Addgene viral prep # 100836-AAV1 ...
-
bioRxiv - Neuroscience 2024Quote: ... pAAV.CAG.GCaMP6f.WPRE.SV40 was a gift from Douglas Kim & GENIE Project (Addgene viral prep # 100836-AAV1; http://n2t.net/addgene:100836; RRID:Addgene_100836)78 ...
-
bioRxiv - Cancer Biology 2024Quote: ... Cells were transduced 48 hours with a lentivirus carrying lentiCas9-Blast vector (Addgene) in complete DMEM medium supplemented with 10 μg/mL polybrene (Santa Cruz) ...
-
bioRxiv - Biochemistry 2024Quote: Homo sapiens TTLL8 (res. 39-585) was cloned into pCoofy28 (Addgene plasmid #44004) by sequence-specific ligation with RecA (43) ...
-
bioRxiv - Biochemistry 2024Quote: ... It was cloned into 438-B vector (kind gift from Scott Gradia; Addgene plasmid # 55219 ...
-
bioRxiv - Biochemistry 2024Quote: ... It was cloned into 438-B vector (kind gift from Scott Gradia; Addgene plasmid # 55219; http://n2t.net/addgene:55219; RRID:Addgene_5521982) in frame with an N-terminal 6xHis tag followed by a TEV cleavage site ...
-
bioRxiv - Biochemistry 2024Quote: ... mMib1-Flag was purchased from Addgene (catalog #37116).
-
bioRxiv - Biochemistry 2024Quote: ... pSpCas9(BB)-2A-Puro (PX459) was a gift from Feng Zhang (Addgene plasmid # 62988) (33).
-
bioRxiv - Biochemistry 2024Quote: ... pMD2.G and psPAX2 were gifts from Didier Trono (Addgene plasmid # 12259 and 12260). Mach1 (Invitrogen ...
-
bioRxiv - Biochemistry 2024Quote: ... The plasmid used to subclone the CFP was a gift from Alice Ting.(67) The pcDNA3-ER-GCaMP3 plasmid from which the cpGFP gene was subcloned was a gift from Jin Zhang (Addgene plasmid # 64854).(68 ...
-
bioRxiv - Biochemistry 2024Quote: ... gifted from Feng Zhang (Addgene plasmid #48138 ...
-
bioRxiv - Biochemistry 2024Quote: ... pCSDest-TMPRSS2 was a kind gift from Roger Reeves 40 (Addgene plasmid # 53887). Human pCCAGS N-terminal cMYC-epitope tagged TMPRSS2 was a kind gift from Stefan Pöhlmann 41 ...
-
bioRxiv - Biochemistry 2024Quote: ... pQCXIP-BSR-GFP11 and pQCXIP-GFP1-10 were a kind gift from Yutaka Hata 39 (Addgene plasmid #68716 and #68715). pCSDest-TMPRSS2 was a kind gift from Roger Reeves 40 (Addgene plasmid # 53887) ...
-
bioRxiv - Biochemistry 2024Quote: ... The resulting plasmid (pJG01) is available from Addgene (#213505), and its sequence is deposited there (www.addgene.org) ...
-
bioRxiv - Biochemistry 2024Quote: ... 500 ng of dead SaCas9 plasmid (Addgene no. 138162), 200 ng of SaCas9 sgRNA plasmid ...
-
bioRxiv - Biochemistry 2024Quote: ... The vector pBAV1K-T5-gfp was a gift from Ichiro Matsumura (Addgene plasmid # 26702 ...
-
bioRxiv - Biochemistry 2024Quote: ... and pMD2.G (Addgene # 12259) packaging vectors and with the transfer plasmid (Txn1 sgRNA CRISPR/Cas9 ...
-
bioRxiv - Biochemistry 2024Quote: ... The vector pBAV1K-T5-gfp was a gift from Ichiro Matsumura (Addgene plasmid # 26702 ; http://n2t.net/addgene:26702 ; RRID:Addgene_26702) (Bryksin and Matsumura 2010) ...
-
bioRxiv - Biochemistry 2024Quote: ... Lambda Phosphatase plasmid was ordered from Addgene (a gift from John Chodera & Nicholas Levinson & Markus Seeliger ; Addgene plasmid # 79748 ; http://n2t.net/addgene:79748 ; RRID:Addgene_79748)33.
-
bioRxiv - Biochemistry 2024Quote: ... and dimeric LZ-VLLRK peptide containing GCN4p1 leucin zipper (RMKQLEDKVEELLSKNYHLENEVARLKKLVGERGSRPSTAKPSKIPVLLRK) were inserted into a EKAR2G_design1_mTFP_wt_Venus_wt vector courtesy of Oliver Pertz (Addgene plasmid #39813 ...
-
bioRxiv - Biochemistry 2024Quote: ... were inserted into a EKAR2G_design1_mTFP_wt_Venus_wt vector courtesy of Oliver Pertz (Addgene plasmid #39813; http://n2t.net/addgene:39813 ; RRID:Addgene_39813).
-
bioRxiv - Biochemistry 2024Quote: ... mCherry-EB1-8 was a gift from Michael Davidson (Addgene plasmid #55035 ...
-
bioRxiv - Biochemistry 2024Quote: ... which was a kind gift from Alice Ting (Addgene #107170). pCMV-SPORT6-MmNIX was purchased from Horizon Discoveries ...
-
bioRxiv - Biochemistry 2024Quote: ... Lambda Phosphatase plasmid was ordered from Addgene (a gift from John Chodera & Nicholas Levinson & Markus Seeliger ...
-
bioRxiv - Biochemistry 2024Quote: ... which was a kind gift from Jonathon Pines (Addgene #40999). All cloned plasmids were validated via Sanger sequencing.
-
bioRxiv - Biochemistry 2024Quote: ... Lambda Phosphatase plasmid was ordered from Addgene (a gift from John Chodera & Nicholas Levinson & Markus Seeliger ; Addgene plasmid # 79748 ...
-
bioRxiv - Biochemistry 2024Quote: ... mCherry-EB1-8 was a gift from Michael Davidson (Addgene plasmid #55035, http://n2t.net/addgene:55035 ; RRID:Addgene_55035). Imaging was performed 24 hours after transfection.
-
bioRxiv - Biochemistry 2024Quote: ... the media was changed to the growth media supplemented with 0.25 mM trans-Cyclooct-2-en – L – Lysine ADGRL3 plasmids with amber codon and pNEU-hMbPylRS-4xU6M15 (pNEU-hMbPylRS-4xU6M15 was a gift from Irene Coin, Addgene plasmid # 105830) were co-transfected (1:1 w/w ...
-
bioRxiv - Biochemistry 2024Quote: An expression plasmid of human GST-Cdk2 was purchased from AddGene (plasmid #61845) and used without further subcloning ...
-
bioRxiv - Bioengineering 2024Quote: ... H2B-iRFP nuclear marker was (Addgene Plasmid #90237). ELP48 was obtained from Addgene (Addgene Plasmid #68395) ...
-
bioRxiv - Biochemistry 2024Quote: ... coli Δlac cells (Addgene, Didovyk et al., 2017) transformed with plasmids encoding β-gal (wild-type or mutant ...
-
bioRxiv - Bioengineering 2024Quote: gRNA plasmids were constructed by cloning the targeted sequences into the pX330 vector (Addgene #42230) via the BbsI sites under the human U6 promoter ...
-
bioRxiv - Bioengineering 2024Quote: ... a gift from David Liu (Addgene plasmid # 132775; http://n2t.net/addgene:132775; RRID; Addgene_132775), was digested by EcoRI and PmeI (Thermo Fisher Scientific) ...
-
bioRxiv - Bioengineering 2024Quote: ... pSpCas9(BB)-2A-GFP (PX458) was a gift from Feng Zhang (Addgene plasmid # 48138 ...
-
bioRxiv - Bioengineering 2024Quote: ... pSpCas9(BB)-2A-GFP (PX458) was a gift from Feng Zhang (Addgene plasmid # 48138; http://n2t.net/addgene:48138; RRID:Addgene_48138). PX458 was digested by EcoRI ...
-
bioRxiv - Bioengineering 2024Quote: All plasmid vector backbones will be available from Addgene upon publication ...
-
bioRxiv - Bioengineering 2024Quote: ... which was a gift from Magnus Essand (Addgene plasmid #80391 ...
-
bioRxiv - Bioengineering 2024Quote: ... which was a gift from James Thomson (Addgene plasmid #20922; http://n2t.net/addgene:20922; RRID:Addgene_80391). β-globin IR was amplified from BAC clone RP11-1205H24 obtained from BACPAC Genomics Inc ...
-
bioRxiv - Bioengineering 2024Quote: ... which was a gift from Magnus Essand (Addgene plasmid #80391; http://n2t.net/addgene:80391; RRID:Addgene_80391). The split puromycin intein sequences were synthesized by Twist Bioscience based on the sequences in Addgene plasmids 134319 and 13431939.
-
bioRxiv - Bioengineering 2024Quote: pU6-pegRNA-GG-acceptor was a gift from David Liu (Addgene plasmid # 132777; http://n2t.net/addgene:132777; RRID; Addgene_132777). pegRNA-GFP and pegRNA-APOE were designed using the PrimeDesign web platform version (https://drugthatgene.pinellolab.partners.org/)20 ...
-
bioRxiv - Bioengineering 2024Quote: ... and exon 2-8 was cloned from Addgene #182141 ...
-
bioRxiv - Bioengineering 2024Quote: pU6-pegRNA-GG-acceptor was a gift from David Liu (Addgene plasmid # 132777 ...
-
bioRxiv - Bioengineering 2024Quote: ... a gift from David Liu (Addgene plasmid # 132775 ...
-
bioRxiv - Biochemistry 2024Quote: ... and 0.34 µg psPAX2 (Addgene #12260) using PEI following standard protocol ...
-
bioRxiv - Biochemistry 2024Quote: ... and Peredox-mCherry (#32380) 35 constructs were obtained from AddGene. Enolase-RFP ...
-
bioRxiv - Biochemistry 2024Quote: ... 0.17 µg VSV.G (Addgene #14888) and 0.34 µg psPAX2 (Addgene #12260 ...
-
bioRxiv - Biochemistry 2024Quote: ... which was a kind gift from Joseph Gordon (Addgene #100796) and V5-miniTurbo-NES in pcDNA3.1 ...
-
bioRxiv - Biochemistry 2024Quote: ... pGEX4T3-GST-Tev was a gift from Robert Sobol (Addgene plasmid # 177142 ...