Labshake search
Citations for Addgene :
451 - 500 of 10000+ citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2024Quote: ... and pDESTtol2pACrymCherry (Addgene, 64023) with LR Clonase II Plus (Invitrogen) ...
-
bioRxiv - Neuroscience 2024Quote: ... PV-Cre mice (N = 5) were injected at the same coordinates with 250 nL of AAV-ef1a-Flex-iChloC-2A-dsRed (Addgene plasmid ...
-
bioRxiv - Neuroscience 2024Quote: ... and pDESTtol2pACryGFP (Addgene, 64022) with LR Clonase II Plus (Invitrogen) ...
-
bioRxiv - Neuroscience 2024Quote: ... p3E-2A-mcherrypA (Addgene, 26031), and pDESTtol2pACryGFP (Addgene ...
-
bioRxiv - Neuroscience 2024Quote: ... a Cre-dependent AAV expressing GCaMP6f under either the CAG promoter (AAV5-CAG-DIO-GCaMP6f, Addgene, diluted to 3.5 × 1012 genome copies/mL ...
-
bioRxiv - Neuroscience 2024Quote: ... The following AAV vectors were purchased from Addgene: AAV5-hSyn-DIO-hM3D(Gq)-mCherry (#44361) ...
-
bioRxiv - Neuroscience 2024Quote: ... Olig001 was a gift from Thomas McCown (Addgene plasmid # 170716; http://n2t.net/addgene:170716; RRID:Addgene_170716)79.
-
bioRxiv - Neuroscience 2024Quote: ... pAAV.CAG.GCaMP6f.WPRE.SV40 was a gift from Douglas Kim & GENIE Project (Addgene viral prep # 100836-AAV1 ...
-
bioRxiv - Neuroscience 2024Quote: ... pAAV.CAG.GCaMP6f.WPRE.SV40 was a gift from Douglas Kim & GENIE Project (Addgene viral prep # 100836-AAV1; http://n2t.net/addgene:100836; RRID:Addgene_100836)78 ...
-
bioRxiv - Cancer Biology 2024Quote: ... The pEGFPC2-CD63 and mCherry-CD81 plasmids (Addgene, USA) were transfected into cells using Lipofectamine 2000 reagent (Invitrogen ...
-
bioRxiv - Cancer Biology 2024Quote: ... Cells were also stably transfected with GFP-CD63 and mCherry-CD81 plasmids (Addgene, USA) for exosomal tracking ...
-
bioRxiv - Cell Biology 2024Quote: ... Lentivectors were co-transfected with packaging plasmids pMD2.G (Addgene plasmid #12259) and psPAX2 (Addgene plasmid #12260) ...
-
bioRxiv - Cell Biology 2024Quote: Lentivectors driving HaloTag or TFIIB-Halo expression were generated by amplifying TFIIB and HaloTag for C-terminal insertion by InFusion cloning into EcoRV-digested pLJM1 (Addgene plasmid #19319 ...
-
bioRxiv - Cell Biology 2024Quote: ... and psPAX2 (Addgene plasmid #12260), gifts of Didier Trono.
-
bioRxiv - Cell Biology 2024Quote: ... TFIIB-2xStrep was then amplified and subcloned into the Sfi1 site of a sleeping beauty plasmid pSBbi-GP (Addgene #60511, gift from Eric Kowarz) derivative lacking EGFP (gift from Nicholas Ingolia ...
-
bioRxiv - Cancer Biology 2024Quote: ... Cells were transduced 48 hours with a lentivirus carrying lentiCas9-Blast vector (Addgene) in complete DMEM medium supplemented with 10 μg/mL polybrene (Santa Cruz) ...
-
bioRxiv - Biochemistry 2024Quote: Homo sapiens TTLL8 (res. 39-585) was cloned into pCoofy28 (Addgene plasmid #44004) by sequence-specific ligation with RecA (43) ...
-
bioRxiv - Biochemistry 2024Quote: ... It was cloned into 438-B vector (kind gift from Scott Gradia; Addgene plasmid # 55219 ...
-
bioRxiv - Biochemistry 2024Quote: ... It was cloned into 438-B vector (kind gift from Scott Gradia; Addgene plasmid # 55219; http://n2t.net/addgene:55219; RRID:Addgene_5521982) in frame with an N-terminal 6xHis tag followed by a TEV cleavage site ...
-
bioRxiv - Animal Behavior and Cognition 2024Quote: ... hSyn_hM4D(Gi)_mCherry (4,59*109/ul; Addgene plasmid #50475); hSyn_DiO_hM4Di-mCherry (4.2*1010/ul ...
-
bioRxiv - Animal Behavior and Cognition 2024Quote: ... hSyn_DiO_hM4Di-mCherry (4.2*1010/ul; Addgene plasmid #44362)] were injected into RE (150 nl ...
-
bioRxiv - Biochemistry 2024Quote: ... mMib1-Flag was purchased from Addgene (catalog #37116).
-
bioRxiv - Biochemistry 2024Quote: ... pSpCas9(BB)-2A-Puro (PX459) was a gift from Feng Zhang (Addgene plasmid # 62988) (33).
-
bioRxiv - Biochemistry 2024Quote: ... pMD2.G and psPAX2 were gifts from Didier Trono (Addgene plasmid # 12259 and 12260). Mach1 (Invitrogen ...
-
bioRxiv - Biochemistry 2024Quote: ... The plasmid used to subclone the CFP was a gift from Alice Ting.(67) The pcDNA3-ER-GCaMP3 plasmid from which the cpGFP gene was subcloned was a gift from Jin Zhang (Addgene plasmid # 64854).(68 ...
-
bioRxiv - Biochemistry 2024Quote: ... gifted from Feng Zhang (Addgene plasmid #48138 ...
-
bioRxiv - Biochemistry 2024Quote: ... pCSDest-TMPRSS2 was a kind gift from Roger Reeves 40 (Addgene plasmid # 53887). Human pCCAGS N-terminal cMYC-epitope tagged TMPRSS2 was a kind gift from Stefan Pöhlmann 41 ...
-
bioRxiv - Biochemistry 2024Quote: ... pQCXIP-BSR-GFP11 and pQCXIP-GFP1-10 were a kind gift from Yutaka Hata 39 (Addgene plasmid #68716 and #68715). pCSDest-TMPRSS2 was a kind gift from Roger Reeves 40 (Addgene plasmid # 53887) ...
-
bioRxiv - Biochemistry 2024Quote: ... The resulting plasmid (pJG01) is available from Addgene (#213505), and its sequence is deposited there (www.addgene.org) ...
-
bioRxiv - Biochemistry 2024Quote: ... 500 ng of dead SaCas9 plasmid (Addgene no. 138162), 200 ng of SaCas9 sgRNA plasmid ...
-
bioRxiv - Biochemistry 2024Quote: pRK5-HA-Ubiquitin-K48 was a gift from Ted Dawson (Addgene plasmid # 17605; http://n2t.net/addgene:17605 ; RRID:Addgene_17605).
-
bioRxiv - Biochemistry 2024Quote: The plasmid pET28b encoding His7-MSP1E3D1 (Addgene) was transformed into E ...
-
bioRxiv - Biochemistry 2024Quote: pRK5-HA-Ubiquitin-K48 was a gift from Ted Dawson (Addgene plasmid # 17605 ...
-
bioRxiv - Biochemistry 2024Quote: ... The vector pBAV1K-T5-gfp was a gift from Ichiro Matsumura (Addgene plasmid # 26702 ...
-
bioRxiv - Biochemistry 2024Quote: ... and pMD2.G (Addgene # 12259) packaging vectors and with the transfer plasmid (Txn1 sgRNA CRISPR/Cas9 ...
-
bioRxiv - Cancer Biology 2024Quote: ... Ovalbumin-expressing B16F10 (B16F10-OVA) was established with pCI-neo-mOVA plasmid (Addgene plasmid #25099) and selected with 1 mg/ml of G418 for 2 weeks as previously described.42,43 All cell lines were maintained at < 70% in culture and tested for mycoplasma contamination every 2 weeks according to MCTP standard protocols.
-
bioRxiv - Biochemistry 2024Quote: ... The vector pBAV1K-T5-gfp was a gift from Ichiro Matsumura (Addgene plasmid # 26702 ; http://n2t.net/addgene:26702 ; RRID:Addgene_26702) (Bryksin and Matsumura 2010) ...
-
bioRxiv - Biochemistry 2024Quote: ... Lambda Phosphatase plasmid was ordered from Addgene (a gift from John Chodera & Nicholas Levinson & Markus Seeliger ; Addgene plasmid # 79748 ; http://n2t.net/addgene:79748 ; RRID:Addgene_79748)33.
-
bioRxiv - Biochemistry 2024Quote: ... and dimeric LZ-VLLRK peptide containing GCN4p1 leucin zipper (RMKQLEDKVEELLSKNYHLENEVARLKKLVGERGSRPSTAKPSKIPVLLRK) were inserted into a EKAR2G_design1_mTFP_wt_Venus_wt vector courtesy of Oliver Pertz (Addgene plasmid #39813 ...
-
bioRxiv - Biochemistry 2024Quote: ... were inserted into a EKAR2G_design1_mTFP_wt_Venus_wt vector courtesy of Oliver Pertz (Addgene plasmid #39813; http://n2t.net/addgene:39813 ; RRID:Addgene_39813).
-
bioRxiv - Biochemistry 2024Quote: ... mCherry-EB1-8 was a gift from Michael Davidson (Addgene plasmid #55035 ...
-
bioRxiv - Biochemistry 2024Quote: ... which was a kind gift from Alice Ting (Addgene #107170). pCMV-SPORT6-MmNIX was purchased from Horizon Discoveries ...
-
bioRxiv - Biochemistry 2024Quote: ... Lambda Phosphatase plasmid was ordered from Addgene (a gift from John Chodera & Nicholas Levinson & Markus Seeliger ...
-
bioRxiv - Biochemistry 2024Quote: ... which was a kind gift from Jonathon Pines (Addgene #40999). All cloned plasmids were validated via Sanger sequencing.
-
bioRxiv - Biochemistry 2024Quote: ... Lambda Phosphatase plasmid was ordered from Addgene (a gift from John Chodera & Nicholas Levinson & Markus Seeliger ; Addgene plasmid # 79748 ...
-
bioRxiv - Biochemistry 2024Quote: ... mCherry-EB1-8 was a gift from Michael Davidson (Addgene plasmid #55035, http://n2t.net/addgene:55035 ; RRID:Addgene_55035). Imaging was performed 24 hours after transfection.
-
bioRxiv - Biochemistry 2024Quote: ... the media was changed to the growth media supplemented with 0.25 mM trans-Cyclooct-2-en – L – Lysine ADGRL3 plasmids with amber codon and pNEU-hMbPylRS-4xU6M15 (pNEU-hMbPylRS-4xU6M15 was a gift from Irene Coin, Addgene plasmid # 105830) were co-transfected (1:1 w/w ...
-
bioRxiv - Biochemistry 2024Quote: An expression plasmid of human GST-Cdk2 was purchased from AddGene (plasmid #61845) and used without further subcloning ...
-
bioRxiv - Bioengineering 2024Quote: ... H2B-iRFP nuclear marker was (Addgene Plasmid #90237). ELP48 was obtained from Addgene (Addgene Plasmid #68395) ...
-
bioRxiv - Biochemistry 2024Quote: ... coli Δlac cells (Addgene, Didovyk et al., 2017) transformed with plasmids encoding β-gal (wild-type or mutant ...