Labshake search
Citations for Thermo Fisher :
5251 - 5300 of 10000+ citations for SARS CoV 2 Spike Glycoprotein S1 Sheep Fc Tag HEK293 Biotin since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Evolutionary Biology 2019Quote: ... Protein products with HA tag were detected using 1:500 anti-HA antibody (Life Technologies, Catalog number: 326700), NURF-1.D isoform with FLAG tag was detected using 1:1000 PIERCE ANTI-DYKDDDDK antibody (Life Technologies ...
-
bioRxiv - Plant Biology 2019Quote: The antibodies used for these ChIP experiments were as follows: GFP Tag Antibody (A-11120, Thermo Fisher Scientific), anti-H3 (Sigma ...
-
bioRxiv - Cancer Biology 2020Quote: ... as per the commercial protocol) and 5 μL of fluorescent tag kit (Alexa Fluor® succinimidyl esters, Invitrogen, Molecular Probes® ...
-
bioRxiv - Neuroscience 2020Quote: ... https://emb.carnegiescience.edu/drosophila-gateway-vector-collection) and PMT-pcBlast-Nterm GFP tag (CuSO4 Inducible promoter, Thermo Fisher V413020).
-
bioRxiv - Plant Biology 2021Quote: ... “Protein extracted” with T7 tag antibodies were incubated with protein A containing magnetic beads (Dyna beads, Thermo fisher) for 2 hours at 4 °C ...
-
bioRxiv - Cancer Biology 2020Quote: ... Full-length EWS/FLI and mutants (all containing amino-terminal 3xFLAG-tags) were cloned into pMSCV-Hygro (Invitrogen) with sequence details provided in Additional file 1 ...
-
bioRxiv - Cell Biology 2021Quote: ... rKLK10 with a 6x C-terminal His tag was affinity purified using HisPur Ni-NTA Resin (Thermo Scientific) per the manufacturer’s instruction (Figure S16 ...
-
bioRxiv - Cell Biology 2021Quote: ... The LAP tag from pIC113 vector (Cheeseman and Desai, 2005) was subcloned into pcDNA5.0/FRT/TO vector (Invitrogen) to make the pcDNA5.0/FRT/TO-LAP-N vector ...
-
bioRxiv - Cancer Biology 2020Quote: ... His-tagged GOT2 protein was immunoprecipitated using the His-tag isolation and pull-down Dynabeads system (Thermo Fisher) using the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2022Quote: ... for immunofluorescence staining or eight-well Lab-Tek chamber coverglass for double-tag analysis (Thermo Fisher Scientific, #155411), and fixed with 4% formaldehyde in PBS for 30 min ...
-
bioRxiv - Biochemistry 2022Quote: ... Individual samples were then labeled with isobaric tags using commercially available TMTsixplex (Thermo Fisher Scientific, P/N 90061) kits ...
-
bioRxiv - Cancer Biology 2022Quote: Isobaric labelling of peptides was performed using the 16-plex tandem mass tag (TMT) reagents (Thermo Fisher Scientific) (Supplementary Table 2) ...
-
bioRxiv - Cell Biology 2022Quote: ... Tags and deletions were confirmed by colony PCR (Master Mix PCR Hot Start II Phire Green, Thermo Fisher) or microscopy analysis ...
-
bioRxiv - Evolutionary Biology 2019Quote: ... We followed standard immunoblot procedures using primary antibodies raised against the Xpress tag (ThermoFisher R910-25, 1:5,000), and anti-mouse IgG HRP-conjugated secondary antibodies (Jackson ImmunoResearch 715-035-150 ...
-
bioRxiv - Neuroscience 2019Quote: The plasmid containing a codon-optimized neurotactin cDNA with 2xHA tag was obtained from GeneArt (ThermoFisher Scientific, USA). C ...
-
bioRxiv - Molecular Biology 2021Quote: ... peptides were resuspended in MS-grade water and labeled with tandem mass tags (TMT 10-plex; Thermo Fisher). Samples were resolved by nano-electrospray ionization on an Orbitrap Fusion Lumos MS instrument (Thermo ...
-
bioRxiv - Cell Biology 2021Quote: ... Primary antibodies (ACE2, dilution 1:100; TMPRSS2, 1:500; CD147, 1:500; 6x-HIS-tag (Invitrogen MA1-21315), 1:1000 ...
-
bioRxiv - Genetics 2022Quote: ... Lysates were subjected to Co-IP using the ProFoundTM c-Myc Tag IP/co-IP Kit (Thermo Scientific) or the Pierce HA Tag IP/Co-IP Kit (Thermo Scientific) ...
-
bioRxiv - Molecular Biology 2022Quote: ... thus leading to a fusion of the emdyp open reading frame with the anti-V5 epitope tag (Invitrogen) and a hexahistidine tag ...
-
bioRxiv - Neuroscience 2022Quote: ... and then incubated for 1hr with a 1:1000 dilution of GST-Tag antibody (MA4-004, Thermo Fisher) in blocking buffer ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... Tetherin localisation in cells was detected by staining cells with anti-HA-tag rabbit monoclonal IgG (Thermo Fisher) diluted in 0.2% Triton X-100 ...
-
bioRxiv - Neuroscience 2024Quote: ... The presence of the Cas9 protein was tested using antibody against the V5 tag (ref R960-25, Invitrogen). Secondary antibodies used for Western blot were labelled with HRP (Jackson Immuno Research) ...
-
bioRxiv - Molecular Biology 2024Quote: ... FLAG M2 or HA-tag antibody at 4 °C overnight before precipitated with magnetic Protein G beads (Thermofisher) for 2 hours at 4 °C followed by 3 washes with RIPA buffer.
-
bioRxiv - Molecular Biology 2024Quote: ... The polyhistidine tag in the insoluble fraction was probed with the SuperSignal West HisProbe Kit (ThermoFisher Scientific 15168) according to the manufacturer’s recommendation with a modification ...
-
bioRxiv - Molecular Biology 2024Quote: ... The washed membrane was then incubated overnight at 5°C with a 6x-His-Tag monoclonal antibody (Invitrogen) diluted 2500-fold in PBS-Tween ...
-
bioRxiv - Genomics 2024Quote: A vector containing the Streptavidin-Binding Peptide (SBP)-Tag was prepared in pEF1 (Thermo Fisher, Cat# V 92120), and SERBP1 ORF was cloned in frame with the His-Myc-tag present in the vector to create pSBP-SERBP1 ...
-
bioRxiv - Biochemistry 2024Quote: ... Reading frames from these pcDNA backbones with 3×HA tags were amplified and inserted into pcDNA4/TO (Invitrogen) containing a C-terminal 3×FLAG affinity tag using Gibson assembly ...
-
bioRxiv - Biophysics 2024Quote: The DNA sequence of parallel Leucine zipper pair GCN4_v4 (LZ, IASRMKQLEDKVEELLSKNYHLENEVARLKKLVGECEGL) and GCN4_v4 with SNAP tag (LZ-SNAP) were customised by GeneArt (Invitrogen) into pMA plasmids ...
-
bioRxiv - Biochemistry 2024Quote: ... Individual samples were then labeled with isobaric tags using commercially available TMTsixplex (Thermo Fisher Scientific, P/N 90061) kits ...
-
bioRxiv - Molecular Biology 2022Quote: ... was used against anti-(c-Myc Tag) and goat anti-Rabbit IgG (H+L) Alexa Fluor 750 (Invitrogen) was used against anti-ENG and anti-β-actin ...
-
bioRxiv - Cell Biology 2023Quote: ... Cells were transfected with CD133 Myc-Tag expression vector (HG15024-CM; SinoBiological) using Lipofectamine 3000 transfection reagent (Invitrogen). For lentivector transfection ...
-
bioRxiv - Microbiology 2023Quote: ... Dm0 (DSHB, ADL67.10), α-Tubulin (Beyotime, AF0001), Flag tag (HUABIO, 0912-1) and GP64 (Invitrogen, 14-6995-85) were used.
-
bioRxiv - Cell Biology 2022Quote: ... four micrograms of desalted peptides were labeled with tandem mass tags (TMT10plex, Thermo Fisher Scientific cat. No 90110) using a 1:20 ratio of peptides to TMT reagent ...
-
bioRxiv - Molecular Biology 2023Quote: ... TMT labeling of each sample were followed by the TMT10plex Isobaric Mass Tag Labeling Kit (Thermo Fisher Scientific) manual ...
-
bioRxiv - Microbiology 2023Quote: ... whereas His-tagged EF-P was detected with primary monoclonal antibodies against the His-Tag (1:10,000; AB_2536841, Invitrogen). Membranes were incubated with the secondary antibodies conjugated with a fluorophore (1:20,000 in TBS ...
-
bioRxiv - Plant Biology 2023Quote: ... with an N-terminal 6xHis tag followed by SUMO fusion protein using Gibson assembly protocol (Thermo Fisher Scientific). Protein was expressed in E ...
-
bioRxiv - Immunology 2024Quote: ... Then MYC-tag-based positive selection was performed using anti-c-Myc magnetic beads (Thermo Fisher Scientific, 88843) to capture the RBD expressing yeasts in the antibody-escaping population after two rounds of negative selection.
-
bioRxiv - Cell Biology 2024Quote: ... was used for 1h blocking and cells were incubated with anti-myc tag primary antibody (MA1-21316, Invitrogen) diluted 1:500 for 2h in RT ...
-
bioRxiv - Bioengineering 2024Quote: ... slides were incubated in primary (HA-tag, Cell Signaling, 3724, 1:800; CD81, Thermo Scientific, 11525542, 1:500) and secondary antibody (AF488 ...
-
bioRxiv - Developmental Biology 2024Quote: ... labelled with Tandem Mass Tag (TMT) ten plex reagents according to the manufacturer’s protocol (Thermo Fisher Scientific, UK) and the labelled samples pooled.
-
bioRxiv - Physiology 2024Quote: ... and labeled by isobaric tags for 1.5 h (TMT 10-plex or 16-plex kit, Thermo Scientific, USA). The reaction was quenched (0.3% hydroxylamine ...
-
bioRxiv - Immunology 2024Quote: ... Blots were blocked for 30 min to 1 h in 5% milk in TBST (1X Tris-buffered saline with 0.1% Tween 20) and then incubated with an anti-6X-His tag primary antibody (1:1,000 dilution, Invitrogen) (overnight ...
-
bioRxiv - Immunology 2021Quote: ... were transfected to HEK293 cells (ATCC® CRL-1573™) and each recombinant protein was purified using HisPur™ Ni-NTA column (Invitrogen, Cat# 88226). The specificity of recombinant protein was further validated by SDS-PAGE and Western blot evaluations.
-
bioRxiv - Molecular Biology 2024Quote: Signaling via the intracellular Ca++ pathway was assessed in stably transfected HEK- HEK293/hPTH1R/glosensor (GP-2.3) cells using the calcium-sensitive fluorophore Fura2-AM (Invitrogen, Life Tech. Grand Island, NY, USA) [73 ...
-
bioRxiv - Neuroscience 2021Quote: The remainder of the light-labeled samples were mixed with the mixture of heavy labeled spike peptides and applied to High-Select™ Fe-NTA Phosphopeptide Enrichment Kit (Thermo fisher Scientific, U.S.A.) to enrich the phosphorylated peptides ...
-
bioRxiv - Immunology 2020Quote: ... cDNA libraries were prepared using 500 pg of total RNA and 1ul of a 1:200,000 dilution of ERCC RNA Spike in Controls (Ambion, Thermo Fisher Scientific, Waltham, MA, USA) using SMARTSeq v2 protocol 71 except for the following modifications ...
-
bioRxiv - Immunology 2019Quote: ... cDNA libraries were prepared using 300 ng of total RNA and 2ul of a 3:1000 dilution of ERCC RNA Spike-In Controls (Ambion® Thermo Fisher Scientific, #4456739). The fragmented mRNA samples were subjected to cDNA synthesis using Illumina TruSeq® RNA sample preparation kit version 2 (Illumina ...
-
bioRxiv - Microbiology 2023Quote: ... fused to a C-terminal C9 tag was generated by sub-cloning the MERS Spike protein from a pLVX-EF1alpha-MERS-Spike plasmid (Weizmann Plasmid Bank) into a pcDNA3.1 expression plasmid using the GeneArt Gibson Assembly HiFi master mix (Thermo Fisher Scientific cat. no. A46627). The following primers were used to generate the vector fragment (Primers V1 ...
-
bioRxiv - Biophysics 2021Quote: ... in the presence of 1/5 biotin-16-dUTP (JenaBioscience, NU-803-BIO16-L) to dTTP (ThermoFisher, 10520651). The PCR was done with primer CD21 (GACCGAGATAGGGTTGAGTG ...
-
bioRxiv - Biophysics 2019Quote: ... in minimal media (1% glycerol, 100 mM potassium phosphate pH 6.0, 0.4 mg L-1 biotin, 1X YNB from Invitrogen) supplemented with 1 mg mL-1 zeocin and cultured in shaker flask for 2 days at 29°C ...