1 - 50 of 749
suppliers found for
6 AMINO 4H 7H 1 3 DITHIINO 5 4 D PYRIMIDIN 8 ONE
» view 10000+ matched products-
Alfa Chemistry Sponsored
Cat# ACM99420696, Inquire Ask
-
Millipore Sigma
No products found because this supplier's products are not listed.bioRxiv - Developmental Biology 2020Quote: ... or 1000 nM of 2-(4-amino-1-isopropyl-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol (PP242; Sigma, P0037), (2 ... -
Tocris
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2019, published in Cerebral Cortex doi: 10.1093/cercor/bhz081Quote: ... and 2-(4-morpholino)-8-phenyl-4H-1-benzopyran-4-one (LY294002, 10µM) (Tocris) were dissolved in DMSO and then added in the external solution at a final concentration of DMSO of 0.001-0.04% ... -
abcam
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2021Quote: ... all strains were grown in YE4S at 32°C and treated with 30 μM 3-Brb-PP1 (3-[(3-Bromophenyl)methyl]-1-(1,1-dimethylethyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine (Abcam) for 1 h and fixed in ice-cold 70% ethanol ... -
Thermo Fisher
No products found because this supplier's products are not listed.bioRxiv - Genomics 2021Quote: The PPMI iPSC lines were thawed and grown on matrigel (Corning)-coated plates with Essential 8 Flex (E8, Batches 1, 2 and 3) or Essential 6 (E6, Batches 4 and 5) media (both Gibco) for about one month (5 passages) ... -
R&D Systems
No products found because this supplier's products are not listed.bioRxiv - Cancer Biology 2021Quote: ... 3 µg/mL anti-ULBP2/5/6 (clone 165903, R&D Systems), and 6 µg/mL anti-ULBP3 (clone 166510 ... -
Cayman Chemical
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2020Quote: ... or the IGF-1R antagonist 7-[cis-3-(1-azetidinylmethyl)cyclobutyl]-5-[3-(phenylmethoxy)phenyl]-7H-pyrrolo[2,3-]pyrimidin-4-amine (NVP-AEW 541, 40 μM; Cayman Chemicals) plus IGF-1 were infused into the IL ... -
Avanti Polar Lipids
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2020, published in Journal of Biological Chemistry doi: 10.1074/jbc.RA119.012517Quote: ... and fluorescently labeled phospholipid 1-oleoyl-2-{6-[(7-nitro-2-1,3-benzoxadiazol-4-yl)amino]hexanoylM-sn-glycero-3-phosphoserine (fPS) were purchased from Avanti Polar Lipids, Inc ... -
Promega
No products found because this supplier's products are not listed.bioRxiv - Cancer Biology 2020Quote: ... 5 and 6 d using a CellTiter 96® AQueous One Solution Cell Proliferation Assay (MTS) (G3582; Promega, Madison, WI). Cells were incubated with the MTS reagent 3-4 h ... -
Santa Cruz
No products found because this supplier's products are not listed.bioRxiv - Pharmacology and Toxicology 2019, published in PLOS ONE doi: 10.1371/journal.pone.0215188Quote: ... 8MM-IBMX (3-Isobutyl-8-(methoxymethyl)-1-methyl-1H-purine-2,6(3H,7H)-dione) was purchased from Santa Cruz Biotechnology (Dallas ... -
Roche
No products found because this supplier's products are not listed.bioRxiv - Developmental Biology 2020Quote: ... 5-Bromo-4-chloro-3-indolyl phosphate (BCIP, [Roche]) and nitro blue tetrazolium chloride (NBT ... -
Calbiochem
No products found because this supplier's products are not listed.bioRxiv - Cancer Biology 2020Quote: ... The 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one (PD98059, MEK inhibitor) and STAT3 inhibitor VI were from Calbiochem (Darmstadt, Germany). The EGF was from Millipore (Billerica ... -
Greiner
No products found because this supplier's products are not listed.bioRxiv - Cancer Biology 2021Quote: Transwell inserts (6-well with 8 µm pores) (Greiner Bio-one) were evenly coated with 75 µL of a 1 mg/mL collagen solution composed of 3 mg/mL rat tail collagen (Gibco) ... -
The Jackson Laboratory
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2021Quote: ... one female 6-8 week old BALB/c mouse (The Jackson Laboratory) was immunized via the intraperitoneal route with 105 plaque forming units (PFU)/ml of A/swine/Missouri/A01727926/2015 (H4N6 ... -
Charles River Labs
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2021Quote: ... Groups of 4-8 female C3H/HeN mice (6-8 weeks old; Charles River Laboratories) were anesthetized with a ketamine-xylazine sedative and intranasally (i.n. ... -
Qiagen
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2021Quote: ... si-USP36-4 (5’-UUCCUUGUGAGUAGCUCUCAA-3’; Qiagen), si-XPO1 (5’-UGUGGUGAAUUGCUUAUAC-3’). -
Merck
No products found because this supplier's products are not listed.Cited in High-fidelity dendritic sodium spike generation in human layer 2/3 neocortical pyramidal neuronsbioRxiv - Neuroscience 2022Quote: ... 4-amino pyridine (5 mM, Merck) and TTX (0.5-1 μM ... -
Takara Bio
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2021Quote: ... 40 μg mL−1 5-Bromo-4-Chloro-3-Indolyl-beta-D-Galactosidase (X-gal, Takara Bio), and 500 μM isopropyl beta-D-1-thiogalactopyranoside (IPTG ... -
Bio-Rad
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2020Quote: Quantity One 1-D Analysis Software (Bio-Rad) was used to estimate band intensities of each sample ... -
Addgene
No products found because this supplier's products are not listed.bioRxiv - Synthetic Biology 2018, published in ACS Synthetic Biology doi: 10.1021/acssynbio.8b00501Quote: ... or pBADHis-B-iRFP (a gift from Vladislav Verkhusha, Addgene plasmid #3 1 8 5 550), under the control of the arabinose inducible araBAD promoter ... -
Becton, Dickinson and Company
No products found because this supplier's products are not listed.bioRxiv - Immunology 2021Quote: ... 7-amino-actinomycin D (7-AAD; BD Pharmingen) was added ... -
Corning
No products found because this supplier's products are not listed.bioRxiv - Cancer Biology 2018, published in Oncogene doi: 10.1038/s41388-018-0365-2Quote: ... female NOD/SCID mice (6~8 weeks) were injected with 3×106 cells per mice in 1:1 matrigel (Corning). Tumor volumes were monitored by digital calipers twice a week and calculated using the formula ... -
Envigo RMS
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2020Quote: Male C57BL/6 mice (3 to 4 weeks old) (Envigo) were intravenously injected (tail-vein ... -
New England Biolabs
No products found because this supplier's products are not listed.Cited in An unconventional myosin, myosin 1d regulates Kupffer’s vesicle morphogenesis and lateralitybioRxiv - Developmental Biology 2018, published in Nature Communications doi: 10.1038/s41467-018-05866-2Quote: ... Somatic and heritable TALEN induced mutations were evaluated by using forward (5’-TTGCTGCAGGTTTGAAAAGGGTCGTA-3’) and reverse (5’-CAGTCTACCTGAGATGACAATGCACG-3’) using primers and One Taq DNA polymerase (NEB: MO0480S). PCR was performed using following cycling conditions ... -
BioLegend
No products found because this supplier's products are not listed.Cited in Multiplexed biochemical imaging reveals caspase activation patterns underlying single cell fatebioRxiv - Cancer Biology 2018Quote: ... 7-AAD (7-amino-actinomycin D; Biolegend; 1:200), CaCl2 (2.5 mM ... -
Cell Signaling Technology
No products found because this supplier's products are not listed.bioRxiv - Developmental Biology 2017, published in Nature doi: 10.1038/nature23678Quote: ... rabbit anti-cleaved caspase 3 (1:200, Cell Signaling, generous gift from D. Bilder 6) rabbit anti-diphospho-ERK (1:400 ... -
PerkinElmer
No products found because this supplier's products are not listed.bioRxiv - Immunology 2021Quote: ... 4 minutes after 3 mg d-luciferin (PerkinElmer) was injected intraperitoneally ... -
Gold Biotechnology
No products found because this supplier's products are not listed.Cited in Maf is a regulator of differentiation for gut immune epithelial cell Microfold cell (M cell)bioRxiv - Developmental Biology 2021Quote: ... X-gal (5-Bromo-4-chloro-3-indoxyl-beta-D-galactopyranoside, Goldbio) was dissolved in dimethylformamide at 50 mg/ml ... -
Hello Bio
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2021Quote: ... 40 μM D-2-amino-5-phosphonovalerate (APV; Hello Bio), and 10 μM bicuculline methiodide (Hello Bio) ... -
Lonza
No products found because this supplier's products are not listed.bioRxiv - Cancer Biology 2020Quote: ... Between 1×10^3 – 5×10^4 cells were re-suspended in 20μl Buffer P3 (Lonza) per reaction and quickly added to the Eppendorf tube containing the CRISPR/Cas9 gRNA RNP complex ... -
World Precision Instruments
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2021Quote: For GBA quantification (n=5 for 4 WPI, n=3 for 8 WPI), the surface function of the Imaris software was used to select only GFP-positive cells by appropriately adjusting the number of voxels as well as the intensity of the GFP channel in the threshold tab ... -
anatrace
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2022Quote: ... and 6-cyclohexyl-1-hexyl-β-D-maltoside (Cymal-6) (Anatrace). Briefly ... -
Peprotech
No products found because this supplier's products are not listed.bioRxiv - Systems Biology 2018, published in PLOS ONE doi: 10.1371/journal.pone.0203244Quote: ... and IL-6) and one murine (Flt-3 ligand) recombinant proteins (all obtained from Peprotech). Isolated PBMNCs were cultured for five days at a cell density of 2.0×106 /2 mL per well in QQ culture medium (Stem Line II ... -
Agilent
No products found because this supplier's products are not listed.Cited in An Ultralong Bovine CDRH3 that Targets a Conserved, Cryptic Epitope on SARS-CoV and SARS-CoV-2bioRxiv - Molecular Biology 2022Quote: ... a J2-4 reverse primer 5’-(GGATAGATCTCTGAGGAGACGGTGACCAGGAG-3’) and HERC II polymerase (Agilent), following the manufacturer’s recommended reaction conditions ... -
Leica
No products found because this supplier's products are not listed.Cited in ASCL1 drives induction of a transitory cell state required for repair of the injured neonatal brainbioRxiv - Developmental Biology 2020Quote: ... Image stacks were obtained every 3-4 minutes for 6-8 hours using a LSM880 (Leica) with an environmental chamber (37°C with 5% CO2) ... -
Polysciences
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2022Quote: ... the polystyrene beads containing surface primary amino groups (PolySciences, 17145-5, Diameter 3 μm) were incubated with 10 mM of Sulfo-NHS-LC-LC-Biotin (ThermoFisher ... -
ibidi
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2021Quote: HuLECs were seeded in a density of 3×104 cells/well one day prior use in a µ-Slide 8 well live-cell chamber (Ibidi). The following day ... -
Jena Bioscience
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2020Quote: ... JBScreen Classic 1-4 and 6 (Jena Bioscience) and Crystal Screen ... -
Vector Labs
No products found because this supplier's products are not listed.bioRxiv - Immunology 2021Quote: ... AEC (3-Amino-9-EthylCarbazole; Vector Laboratories, Burlingame, CA) was used as chromogen ... -
VWR
No products found because this supplier's products are not listed.bioRxiv - Synthetic Biology 2020Quote: ... 3-D spheroids were generated by seeding 2.0E6 cells per well of a 6-well cell repellent plate (VWR) in a final volume of 4.0 mL complete media and placed on an orbital shaker at 95 RPM for 24 hours ... -
Electron Microscopy Sciences
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2020Quote: ... 8% (w/v) paraformaldehyde (PFA; 4% final concentration; 157-8, Electron Microscopy Sciences), distilled water ... -
GE Life Sciences
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2020Quote: ... was amplified by PCR using the primers (5’-GGTTCCGCGTGGATCCATGTCTCATGCAGCCGAGCCA-3’ and 5’-GGAATTCCGGGGATCCTCAGGACTCCTCTTCAATGCTGA-3’) and cloned into BamHI site of pGEX-4T-1 expression vector (GE Healthcare) using In-Fusion HD Cloning System (Clontech) ... -
Carbosynth
No products found because this supplier's products are not listed.bioRxiv - Biochemistry 2021Quote: 0.5 mg TDP-6-deoxy-D-xylo-4-hexulose (Carbosynth) was incubated in deuterated buffer alone ... -
Beckman
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2021Quote: ... KG, Staufen, Germany) (position 6, 4 × 5-s bursts) and subsequently centrifuged at 48,000g at 4°C (Beckman Avanti J-251 Ultracentrifuge ... -
Stemcell Technologies
No products found because this supplier's products are not listed.bioRxiv - Cell Biology 2021Quote: ... H9-hESC SOX10::GFP reporter and H20961 iPSC were passaged ∼1:6 every 4-5 days by incubating them in ReLeSR (StemCell technologies) for 1 min at room temperature ... -
National Diagnostics
No products found because this supplier's products are not listed.bioRxiv - Microbiology 2021Quote: ... of total RNA were fractionated on 8% polyacrylamide urea gels containing 6 M urea (1:4 mix of Ureagel Complete to Ureagel-8 (National Diagnostics) with 0.08% ammonium persulfate ... -
Biosearch Technologies
No products found because this supplier's products are not listed.Cited in Mouse hepatitis virus nsp14 exoribonuclease activity is required for resistance to innate immunitybioRxiv - Microbiology 2017, published in Journal of Virology doi: 10.1128/JVI.01531-17Quote: ... A 5' 6-carboxyfluorescein (FAM)-labeled probe (5'-TTCTGACAACGGCTACACCCAACG-3' [Biosearch Technologies]) was used with forward (5'-AGAAGGTTACTGGCAACTG-3' ... -
Eurogentec
No products found because this supplier's products are not listed.bioRxiv - Epidemiology 2018Quote: ... 0.1 μM concentration of probe panCh16S (5′-FAM [6-carboxyfluorescein]- CTACGGGAGGCTGCAGTCGAGAATC-BHQ1 [black hole quencher 1]-3′) (Eurogentec); (iv ... -
Microchem
No products found because this supplier's products are not listed.bioRxiv - Developmental Biology 2021Quote: ... One layer of photoresist (SU-8 2075, Microchem) is spun onto a silicon wafer at a thickness of 110μm ... -
GenScript
No products found because this supplier's products are not listed.bioRxiv - Neuroscience 2017, published in The Journal of Neuroscience doi: 10.1523/jneurosci.3505-17.2018Quote: ... The retro-inverso Tat-beclin 1 peptide D-amino acid sequence (RRRQRRKKRGYGGTGFEGDHWIEFTANFVNT; synthesized by GenScript through Funakoshi Co. ... -
Illumina
No products found because this supplier's products are not listed.Cited in Dual roles of mTORC1-dependent activation of the ubiquitin-proteasome system in muscle proteostasisbioRxiv - Physiology 2021Quote: ... 3’ and 5’ adaptors (Illumina) were ligated and the resulting product was reverse transcribed to generate cDNA by PCR ...