Labshake search
Citations for GenScript :
3251 - 3300 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... C-terminal amidated and N-terminal acetylated hexapeptides representing regions of amyloidogenic behavior (as predicted by ZipperDB) were sourced from GenScript at >= 95% purity ...
-
bioRxiv - Plant Biology 2022Quote: ... the aphid (Myzus persicae) effector Mp10 was used as a positive control 72 Flg22 (cat. no. RP19986, GenScript) was used as an inducer of ROS production ...
-
bioRxiv - Neuroscience 2022Quote: ... and captured on a 15 mL column Protein A Sepharose resin (Genscript), beads were washed with 50 column volumes of PBS and eluted with glycine buffer pH 3.0 into 1.5 M Tris-HCl pH 8.0 before overnight dialysis into PBS pH 7.5 ...
-
bioRxiv - Neuroscience 2022Quote: ... Cys-TAT (CYGRKKRRQRRR) and RVG-Cys (YTIWMPENPRPGTPCDIFTNSRGKRASNGC) were synthesized by Genscript. Nuclear localization signal (NLS)-tagged Streptococcus pyogenes Cas9 nuclease (sNLS-SpCas9-sNLS ...
-
bioRxiv - Immunology 2022Quote: ... HCoV-HKU1 and HCoV-OC43 prefusion S and the SARS-CoV-2 postfusion S ectodomains were synthetized by Genscript or GeneArt and cloned in the phCMV1 vector ...
-
bioRxiv - Immunology 2022Quote: ... Plasmids encoding for RBDs of different sarbecoviruses were synthetized by Genscript and cloned in the phCMV1 vector ...
-
bioRxiv - Immunology 2022Quote: ... was synthetized by Genscript and cloned in the phCMV1 vector ...
-
bioRxiv - Microbiology 2022Quote: Peptides SDLPFEH (G9241 PapR7) and KDLPFEY (ATCC14579 PapR7) were synthesised by GenScript (USA) at a purity >98% and diluted with sterile nuclease-free water ...
-
bioRxiv - Neuroscience 2022Quote: ... and CAG sequences were synthesized by GenScript (NJ, USA). Restriction enzymes and T4 DNA ligase were sourced from New England Biolabs (VIC ...
-
bioRxiv - Physiology 2022Quote: ... and incubated with a custom polyclonal primary antibody against coral soluble adenylyl cyclase (sAC; GenScript). This antibody was designed against sAC expressed by the coral Acropora digitifera (Barott et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... The indicated mutations were generated by direct DNA synthesis (GenScript, Nanjing, China). The luciferase reporter assay was performed 48 h after co-transfection of the reporter vectors with NC ...
-
bioRxiv - Neuroscience 2022Quote: ... DNA encoding the Human isoforms of neuropeptide B (based on the sequences NP-202, NM_148896.5) or neuropeptide W (based on the sequences NPW-201, NM_001099456.3) were chemically synthesized (GenScript) and UAS-NPB and UAS-NPW were generated using the same protocol described for UAS-mmt.
-
bioRxiv - Neuroscience 2022Quote: Human Stathmin expression clones were from Genscript (STMN1-OHu14092D ...
-
bioRxiv - Plant Biology 2022Quote: ... Sample in the gel were transferred to PVDF membrane using eBlot™ L1 (GenScript Corporation). Anti-HA (1:5 ...
-
bioRxiv - Plant Biology 2022Quote: ... samples were run on a 4%-20% gradient protein gels (GenScript, SurePAGE, Cat. No. M00655) and stained with Fast Silver Stain Kit (Beyotime ...
-
bioRxiv - Plant Biology 2022Quote: Proteins were loaded onto 4%-20% gradient protein gels (GenScript, SurePAGE, Cat. No. M00655) and 4%-20% Precast Protein Plus Gel (Yeasen ...
-
bioRxiv - Synthetic Biology 2022Quote: Individual capsids were cloned into iCAP-AAV9 (K449R) backbone (GenScript), produced as described above ...
-
bioRxiv - Immunology 2022Quote: ... the four genes for each multispecific antibody were synthesized using human preferred codons (GenScript) and cloned into eukaryotic expression vectors ...
-
bioRxiv - Immunology 2022Quote: ... or via synthesis and cloning (Genscript) as previously reported 18,38 ...
-
bioRxiv - Genomics 2022Quote: ... The cDNA encoding TeNT-LC-HN (residues 1-870) and TeNT-HC were synthesized by GenScript (Piscataway, NJ). A thrombin protease cleavage site was inserted between I448 and A457 in both TeNT-LC-HN and chTeNT-LC-HN ...
-
bioRxiv - Immunology 2022Quote: ... crRNAs were selected from CRISPR sgRNA database of (Genscript, USA). crRNA ...
-
bioRxiv - Immunology 2022Quote: ... IFNmod was subjected to ToxinEraserTM (GenScript, L00338), with endotoxin levels measured using ToxinSensorTM (GenScript ...
-
bioRxiv - Immunology 2022Quote: ... with endotoxin levels measured using ToxinSensorTM (GenScript, Cat# l00350). Yields were ∼15 mg pure protein per liter.
-
bioRxiv - Biochemistry 2022Quote: ... Particular mutants were prepared from a p35S::GFP-MtABCG46 construct by GenScript. All plasmid constructs were confirmed by DNA sequencing.
-
bioRxiv - Immunology 2022Quote: ... β-actin (GenScript, 1:15,000), goat anti-mouse (Jackson Immunoresearch ...
-
bioRxiv - Microbiology 2022Quote: ... Heterologous expression was detected by electroblotting SDS-PAGE Tris-glycine gels onto nitrocellulose membranes and immunostaining with primary rabbit anti-His-tag antibody and secondary goat anti-rabbit IgG phosphatase alkaline conjugated antibody (GenScript, Piscataway, NJ, USA) (Suppl ...
-
bioRxiv - Microbiology 2022Quote: ... PGAM5-FLAG-pcDNA3.1 and TOMM70A-FLAG-pcDNA3.1 constructs were purchased directly from GenScript (GenScript, Netherlands).
-
bioRxiv - Microbiology 2022Quote: ... 100 μL of cell lysate was saved as an input control and the remaining cell lysate was incubated with Glutathione MagBeads (GenScript, L00327) overnight at 4°C ...
-
bioRxiv - Microbiology 2022Quote: ... by GenScript.
-
bioRxiv - Microbiology 2022Quote: ... and 10 betasheets of a modified mNeonGreen synthesized by Genscript. For the transfection of TMPRSS2 ...
-
bioRxiv - Microbiology 2022Quote: ... was assembled from a PCR performed on a codon-optimized SARS-CoV-2 Omicron BA.1 sequence synthesized by Genscript. Fragments were assembled with a PCR fragment containing the fpl and mNG2(11 ...
-
bioRxiv - Biochemistry 2022Quote: ... aureus strain COL was synthesized and codon-usage was optimized for expression in Escherichia coli by GenScript USA Inc ...
-
bioRxiv - Microbiology 2022Quote: ... This codon-optimized version of dcas9 (Bbdcas9) was synthesized and cloned in pBluescript II KS (+) with flanking 5’ NdeI and 3’ NotI restriction endonuclease sites (GenScript), yielding pBS-Bbdcas9 ...
-
bioRxiv - Microbiology 2022Quote: ... A3 to A10 primers were synthesized by GenScript Biotech ...
-
bioRxiv - Microbiology 2022Quote: ... and ZIKV (GenBank accession no. NC012532, UniProt accession no. Q32ZE1) were commercially synthesized and cloned into plasmid pUC57 by GenScript Biotech ...
-
bioRxiv - Neuroscience 2022Quote: ... as measured through LAL chromogenic endotoxin quantification (GenScript, Inc.). Protein concentration was determined by UV absorption at 280 nm using a nanodrop system (Thermofisher ...
-
bioRxiv - Neuroscience 2022Quote: ... and endotoxin levels were then reduced through multiple passes through endotoxin removal columns (GenScript, Inc.) to achieve contaminating endotoxin units below 0.1 per mg of protein ...
-
bioRxiv - Neuroscience 2022Quote: ... Plasmid pAAV-CamKII-Nptx2-V5 was generated by GenScript, by cloning a synthesized CamKII-Nptx2-V5-miR204 DNA fragment upstream of the WPRE-hGHpA sequence of a plasmid derived from plasmid CAG-NLS-GFP (a gift from Viviana Gradinaru ...
-
bioRxiv - Neuroscience 2022Quote: ... was synthesized with a gene synthesis service (GenScript). We inserted KpnI and EcoRI restriction sites into the 5’ and 3’ ends of the PSDΔ1,2 sequence by amplifying the PSDΔ1,2 gene with overhang PCR primers containing Kpn1 and EcoR1 ...
-
bioRxiv - Neuroscience 2022Quote: ... constructs were generated by Genscript (Piscataway, NJ) that expressed either mCherry alone ...
-
bioRxiv - Neuroscience 2022Quote: sgRNA oligonucleotides and dsDNA donor templates for mAvicFP1/mCherry insertion were designed using the program Benchling and synthesised by GenScript. The sgRNA sequence (5’-GCTGGGGAATGTAGACAGTG-3’ ...
-
bioRxiv - Neuroscience 2022Quote: ... or pLenti-TDP-43ΔNLS/2KQL-C-mGFP (Origene, mutations by GenScript). Cells were seeded onto coverslips in 24-well plates at a density of 25,000 cells/well and incubated for 24 h ...
-
bioRxiv - Synthetic Biology 2022Quote: ... This gene was codon optimized for human cell expression and made in the CMV/R mammalian expression vector by Genscript. Transient transfection into HEK293F cells was carried out using PEI MAX ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: Gα C terminal peptides were purchased from GenScript Biotech (New Jersey ...
-
bioRxiv - Neuroscience 2022Quote: ... A ∼3.7 kbp donor repair construct was cloned into pUC57 vector at the EcoRV site by GenScript (Nanjing, China). The donor plasmid consists of the corrected CLN3 sequence with loxP-flanked puromycin-selection cassette flanked by 801-911 bp of homologous sequence.
-
bioRxiv - Pharmacology and Toxicology 2022Quote: Neutralizing antibodies against the SARS-CoV-2 in hamster blood plasma were determined using the “SARS-CoV-2 Surrogate Virus Neutralization test kit” (GenScript, USA).
-
bioRxiv - Molecular Biology 2022Quote: ... The midguts were then incubated with primary antibody for liberibacter with anti-OmpB-antibody (GenScript), followed by secondary antibody conjugated with Cy3/Cy5 (Jackson ImmunoResearch Laboratories) ...
-
bioRxiv - Molecular Biology 2022Quote: ... The membranes were probed with anti-GFP (0.5 µg/mL, chicken polyclonal; Genscript, Piscataway, NJ, USA) and anti-β-actin (1 µg/mL ...
-
bioRxiv - Molecular Biology 2022Quote: ... N-terminal 6xHis-Flag-tagged SUMO2 was cloned into BamH1 and Xho1 restriction sites of pcDNA5/FRT/TO plasmid by gene synthesis (GenScript Biotech). All primers used for site-directed mutagenesis are listed in supplementary table 1.
-
bioRxiv - Molecular Biology 2022Quote: ... The gene coding for γ-glutamyl phosphate reductase was ligated into the pHTP1 expression vector (GenScript Biotech, Netherlands) producing a recombinant protein which contains an N-terminal hexahistidine and Kanamycin resistance ...