Labshake search
Citations for GenScript :
3201 - 3250 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2022Quote: ... while the TAP antibody (Genscript, Inc) and the HA monoclonal antibody 2-2.2.14 (Invitrogen ...
-
bioRxiv - Microbiology 2022Quote: ... the chromatography column was resuspended with 1 ml TCB as well as 20 μl (200 U) of TE protease enzyme (Genscript, Inc) on a rotator and the columns incubated at 4°C for 16 hours ...
-
bioRxiv - Microbiology 2022Quote: ... fumigatus-optimized fluorescent protein mNeonGreen by using vector pSR25 (synthesized by GenScript, Piscataway, NJ). Primer pairs AtrR-CoNG MH F (CCCGGTCTTCGACACCA ATGGTCCACCCCACGGTGGATTGGCTGGTGCCGGTGCTGGT ...
-
bioRxiv - Microbiology 2022Quote: ... were commercially synthesized and cloned into the multiple clone sites of NdeI/XhoI in vector pET-29a(+) (GenScript, USA), and then were transformed into E ...
-
bioRxiv - Molecular Biology 2022Quote: Biotinylated peptides (synthetised by Genscript) were resuspended in DMSO ...
-
bioRxiv - Microbiology 2022Quote: The SARS-CoV-2 Wuhan-Hu-1 RBD construct was synthesized by GenScript into pcDNA3.1-with an N-terminal mu-phosphatase signal peptide and a C-terminal octa-histidine tag ...
-
bioRxiv - Microbiology 2022Quote: ... Recombinant antibody was cloned and produced by Genscript. Briefly ...
-
bioRxiv - Microbiology 2022Quote: ... synthesized (GenScript) and cloned into the NotI and SpeI sites of b3D.DT^H.^D (provided by Dr ...
-
bioRxiv - Molecular Biology 2022Quote: ... MonoRabTM HRP Rabbit anti-Camelid VHH antibody (GenScript #A01861) was used to detect vhhGFP fusion proteins ...
-
bioRxiv - Molecular Biology 2022Quote: IgGFc: Human IgG Fc Sequence (Supplementary Material Figure S1) was codon optimized for HEK293 expression and synthesized from Genscript USA in pUC57 vector ...
-
bioRxiv - Molecular Biology 2022Quote: ... It was chemically synthesized and inserted into a pUC57 based vector (GenScript). The encoding DNA fragment of the INSL5 precursor was confirmed by DNA sequencing ...
-
bioRxiv - Microbiology 2022Quote: ... Rabbit IgG Control (GenScript).
-
bioRxiv - Microbiology 2022Quote: ... Supernatant was collected pre-cleared with 20 µl Protein A/G MagBeads (GenScript) per 1.5 ml lysate for 30 minutes ...
-
bioRxiv - Microbiology 2022Quote: ... or mouse anti-FLAG antibody (anti-DYKDDDDK antibody, Genscript) with Pierce ECL Western Blotting Substrate (Thermo Fisher Scientific).
-
bioRxiv - Molecular Biology 2022Quote: MFcS2: Modified human ACE2 (Sequence-Supplementary Material S1) was codon optimized for HEK293 expression and synthesized from Genscript USA in pUC57 vector ...
-
bioRxiv - Microbiology 2022Quote: ... were synthesized and cloned into pcDNA3.1+ (GenScript). All DNA constructs were verified by Sanger sequencing (ACGT) ...
-
bioRxiv - Microbiology 2022Quote: ... was synthesized based on MARV strain Musoke (GenBank: DQ217792) by GenScript Biotech ...
-
bioRxiv - Microbiology 2022Quote: ... synthesized and codon-optimized by GenScript Biotech (GenScript Biotech, Piscataway, NJ, USA). pUC57 vectors containing the codon-optimized sequences of VP30 ...
-
bioRxiv - Microbiology 2022Quote: ... THE V5 Tag Antibody (1:2000, GenScript Biotech) was used as primary antibody for samples and mouse anti-clathrin heavy chain clone 23 (1:2,000 ...
-
bioRxiv - Microbiology 2022Quote: ... synthesized and codon-optimized by GenScript Biotech (GenScript Biotech ...
-
bioRxiv - Microbiology 2022Quote: ... These spike sequences were synthesized and cloned into pcDNA3.1+(GenScript). Human and hamster ACE2 (Q9BYF1.2 and GQ262794.1 ...
-
bioRxiv - Molecular Biology 2022Quote: ... After clearance by ultracentrifugation (45 min, 120,000 g) the lysates were incubated with either FLAG-antibody- coated beads (Genscript, L004332-5) or Strep-Tactin®XT 4Flow high capacity resin (IBA life sciences ...
-
bioRxiv - Molecular Biology 2022Quote: ... fixed cells were incubated with MonoRabTM iFluor 647 Rabbit Anti-Camelid VHH antibody (GenScript A01994) and Hoechst 33342 diluted in blocking buffer for 1 hour at room temperature ...
-
bioRxiv - Neuroscience 2022Quote: ... The neuropeptide Gly1-SIFamide (GYRKPPFNG-SIFamide, custom peptide synthesis: Genscript) (Blitz et al ...
-
bioRxiv - Synthetic Biology 2022Quote: ... thompsoni lipase sequence was synthesised and codon optimised by GenScript (Leiden, Netherlands). Codon optimisation increased the GC content from 44.4% to 55% ...
-
bioRxiv - Synthetic Biology 2022Quote: Individual capsids were cloned into an iCAP-AAV9 (K449R) backbone (GenScript), produced as described above with a DNA genome that encodes nuclear localized GFP under a CAG promoter ...
-
bioRxiv - Synthetic Biology 2022Quote: ... coli strain DH10B/TOP10 was as previously described.14,15 Bacterial THI4s were codon-optimized for yeast and synthesized by GenScript (Piscataway, NJ); the recoded sequences are given in Table S1 ...
-
bioRxiv - Synthetic Biology 2022Quote: ... The resulting chimeric DNA sequence was flanked a 3’-BamHI and 5’-EcoRI sites and commercially synthesised (GenScript, Rijswijk, Netherlands) into vector pUC19 (pJGUC01) ...
-
bioRxiv - Synthetic Biology 2022Quote: ... The KSI-eGFP was obtained from Genscript (prepared by inserting the synthesized eGFP gene after KSI sequence that was already present in pET-31b(+ ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: Codon-optimized µDys was synthesized by Genscript (Piscataway, NJ) and cloned into a pAAV shuttle plasmid containing the striated muscle-specific CK8 promoter (20 ...
-
bioRxiv - Pathology 2022Quote: ... Jagged-1 peptide (1 uM, Genscript), Y-27632 (10 uM ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... 100 μM PKTPPKAKKL substrate (GenScript), and varying concentrations of cyclin A (5 ...
-
bioRxiv - Pathology 2022Quote: ... bat sera were screened at a 1:10 dilution using a competitive enzyme linked immunosorbent assay (SARS-CoV-2 sVNT, GenScript, Piscataway, New Jersey) according to the manufacturer’s instructions ...
-
bioRxiv - Synthetic Biology 2022Quote: DNA chunks comprising ∼5-10 Kb of each megachunk were synthesized and sequence verified by Genscript (megachunks A-K and N-X), GeneArt (megachunks L ...
-
bioRxiv - Synthetic Biology 2022Quote: ... The entire pVANT sequence was synthesized de novo (GenScript, NJ, USA) and cloned into E ...
-
bioRxiv - Neuroscience 2022Quote: ... were synthesized by Genscript (Genscript Corp., Nanjing, China) and cloned into the mammalian expression vector pCMV-blank ...
-
bioRxiv - Neuroscience 2022Quote: ... and Boleophthalmus pectinirostris) were synthesized by Genscript (Genscript Corp., Nanjing, China) and cloned into the mammalian expression vector pCMV-blank ...
-
bioRxiv - Plant Biology 2022Quote: ... specific rabbit His-tag antibody (GenScript, A00174-40) or anti-monoubiquityl-histone H2B (Lys-120 ...
-
bioRxiv - Plant Biology 2022Quote: ... The DNA donor template for gene knock-in was synthesized by GenScript (Piscataway, NJ, USA) and cloned into pBGWD0 vector (Gateway vector VIB ...
-
bioRxiv - Plant Biology 2022Quote: ... whereas the autoubiquitination was detected by IB analysis with anti-GST (A00865-200, 1:5,000, Genscript) as primary antibody ...
-
bioRxiv - Plant Biology 2022Quote: ... The immunoprecipitated proteins were separated by SDS-PAGE electrophoresis and detected by anti-GST (A00865-200, 1:5,000, Genscript) and anti-MBP (E8032 ...
-
bioRxiv - Plant Biology 2022Quote: ... His-FmASP protein was detected by immunoblotting with using a mouse anti-His antibody (GenScript, A00186). The immunoblotting band signals were visualized by enhanced enhanced chemiluminescence (ECL ...
-
bioRxiv - Plant Biology 2022Quote: ... The stock solutions of peptide elicitors systemin and flg22 (GenScript) were solved in water.
-
bioRxiv - Plant Biology 2022Quote: ... and used it to raise a polyclonal antibody in rabbit (Genscript). Anti-AtSMC3 and anti-GFP (Roche 11814460001 ...
-
bioRxiv - Neuroscience 2022Quote: ... All three constructs were made from DNA sequences from GenScript (Piscataway, NJ) which were codon optimized for expression in E ...
-
bioRxiv - Plant Biology 2022Quote: ... and SCPSsC3C5 (SAYTCAAPAKSHLTAESDYWVFYWGNEGVSPGVGST) (GenScript) were prepared as 10 mM stock solutions in 100% dimethyl sulfoxide (DMSO ...
-
bioRxiv - Plant Biology 2022Quote: ... Sequences starting after the residue corresponding to butelase-1-L26 or after the signal peptide predicted using SignalP5.0 were cloned into the pET28a(+) vector at Ndel/Xhol restriction sites to generate a His6-fusion protein construct (Genscript, USA). Point mutations were generated using a Q5 mutagenesis kit (New England Biolabs ...
-
bioRxiv - Plant Biology 2022Quote: ... Synthetic GLV10p (DY(SO3-)PKPSTRPPRHN) was obtained from Genscript (>70% purity). Emerged LR numbers were counted on 12DAG seedlings using a stereo microscope ...
-
bioRxiv - Neuroscience 2022Quote: Artificial promoter constructs were synthesized and subcloned into an AAV vector backbone plasmid by a commercial supplier (Genscript), placed upstream of GFP for histology and gene expression experiments ...
-
bioRxiv - Neuroscience 2022Quote: DNA encoding mScarlet (Bindels et al., 2016) was synthesized (Genscript, USA) and fused in frame without a linker to human H2B (H2BC11 ...