Labshake search
Citations for Agilent :
751 - 800 of 2353 citations for SARS CoV 2 Spike Glycoprotein S2 aa 800 1000 His Tag E. coli since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... GFAP (rabbit, 1:1000, Dako, Z0334); Red Fluorescent Protein (RFP ...
-
bioRxiv - Neuroscience 2022Quote: ... rabbit GFAP 1:1000 (Agilent Z0334). Slides were washed 3x PBST then incubated with secondary antibody 1:500 in in 5% normal goat or normal donkey serum in PBST for 1 hour at room temperature ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-GFAP (1:1000, Dako), and anti-human Tau (1:500 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-GFAP (Dako;1:1000), rabbit anti-ALDH1L1 (Abcam ...
-
bioRxiv - Cancer Biology 2023Quote: ... HRP conjugated (Dako #P0448; 1:1000). Proteins were visualized using ECL Western Blotting detection reagent (Amersham #RPN2106 ...
-
bioRxiv - Cancer Biology 2023Quote: ... HRP conjugated (Dako #P0447; 1:1000), goat a-mouse IgG ...
-
bioRxiv - Neuroscience 2023Quote: ... anti-Tuj1 (1:1000, Dako, #G7121), anti-Iba1 (1:500 ...
-
bioRxiv - Cancer Biology 2023Quote: ... using the DNA 1000 kit (Agilent). Multiplexed libraries (10ρM ...
-
bioRxiv - Microbiology 2023Quote: ... and final size determined by Agilent DNA 1000 Kit (Agilent, #5067-1504) on the Agilent Bioanalyzer.
-
bioRxiv - Genetics 2021Quote: ... The obtained chromatograms were analyzed with the software Enhanced Chemstation E.01.00.237 (Agilent, Santa Clara, CA, USA). Peak identification was carried out automatically with the initial area reject parameter set to 0 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: E-cigarette liquids were diluted 100X into spectral grade methanol and injected into the GCMS detector (Agilent 7890A gas chromatograph with 5975 MSD detector) ...
-
bioRxiv - Biochemistry 2020Quote: ... All E protein variants were obtained by site-directed mutagenesis using QuikChange kit (Stratagene, La Jolla, California) and were confirmed by sequencing the plasmid DNA at Macrogen Company (Seoul ...
-
bioRxiv - Biophysics 2022Quote: ... Relative permittivity and electrical conductivity were measured using a dielectric probe kit (85070 E, Agilent Tech. Inc.) for a range of frequency between 950 MHz and 2400 MHz and heat capacitance was measured using a KD2 thermal properties analyzer (Decagon Devices Inc.).
-
bioRxiv - Biophysics 2022Quote: ... Relative permittivity and electrical conductivity were measured using a dielectric probe kit (85070 E, Agilent Tech. Inc.) for a range of frequency between 950 MHz and 2400 MHz and heat capacitance was measured using a KD2 thermal properties analyzer (Decagon Devices Inc.).
-
bioRxiv - Immunology 2022Quote: ... Each sample slide was stained with H&E (Hematoxylin Dako #S3309, Eosin, Dako #CS701, bluing buffer #CS702) and the brightfield images were captured via Leica whole-slide scanner at 10X resolution.
-
bioRxiv - Plant Biology 2023Quote: ... mass calibrant using the “atune.u” autotune method provided with Agilent GC/MSD Productivity ChemStation Software (Revision E.02.01.1177; Agilent Technologies ...
-
bioRxiv - Molecular Biology 2019Quote: ... The C-terminal hexahistidine tag was brought in frame by QuikChange II XL site-directed mutagenesis (Agilent #200521) using the following primers ...
-
bioRxiv - Synthetic Biology 2021Quote: ... 34 plasmids encoding new quantification tag (LVXXLTK) were amplified using PfuUltra II Fusion HS DNA Polymerase (Agilent Technologies) using appropriate DNA primers (Table S7) ...
-
bioRxiv - Biochemistry 2023Quote: ... 800 µL sample and MTBSTFA (100 µL, N-tert-butyldimethylsilyl)-N-methyltrifluoroacetamide) were transferred to amber capped glass vials (Agilent Technologies, USA), heated to 80 °C for 20 min ...
-
bioRxiv - Immunology 2021Quote: QuikChange Lightening Site-Directed Mutagenesis kit was used to generate amino acid substitutions in the SARS-CoV-2 Wuhan Spike expression vector (Seow et al., 2020) or the D614G pCDNA Spike plasmid (S. A. Kemp et al., 2020) following the manufacturer’s instructions (Agilent Technologies, Inc., Santa Clara, CA). Spike B.1.1.7 was synthesised by Genewiz ...
-
bioRxiv - Biophysics 2021Quote: Aβ42 (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) was expressed recombinantly in the Escherichia coli BL21 Gold (DE3) strain (Stratagene, CA, USA), and purified as described previously15 ...
-
Mechanical forces impair antigen discrimination by reducing differences in T cell receptor off-ratesbioRxiv - Immunology 2022Quote: ... TCR α and β chains were expressed in BL21 (DE3)-RIPL Escherichia coli cells (Agilent Technologies) following induction with 0.15 mM IPTG ...
-
bioRxiv - Biophysics 2019Quote: ... Escherichia coli XL10-Gold and BL21(DE3) Gold cells were purchased from STRATAGENE (San Diego, CA). 6-Acryloyl-2-Dimethylaminonaphthalene (Acrylodan) ...
-
bioRxiv - Biophysics 2020Quote: ... were prepared by expression in Escherichia coli BL21 (DE3) Gold Strain (Agilent Technologies, Santa Clara, USA)46 ...
-
bioRxiv - Neuroscience 2020Quote: ... All recombinant proteins were expressed in the BL21-Gold (DE3) pLysS strain of Escherichia coli (Agilent) in pGEX-KG vectors as glutathione S-transferase (GST ...
-
bioRxiv - Biochemistry 2022Quote: ... coli LacI DBD (1121 variants in total) were synthesized as single-stranded oligonucleotide pools (Agilent Technologies). Extant DBDs exceeding 60aa long were truncated from the N-terminus to 60 residues in length to comply with DNA synthesis restrictions ...
-
bioRxiv - Biochemistry 2023Quote: ... SUV420H1 plasmid was transformed into Escherichia coli BL2-codon plus (DE3)-RIL competent cells (Agilent technologies) and grown in 2xYT-Kan media ...
-
bioRxiv - Cell Biology 2023Quote: ... and the expression vector was introduced into an Escherichia coli strain BL21-CodonPlus (DE3)-RIL (Agilent). The transformed bacterial cells were grown at 37°C until OD600 reached 0.7 ...
-
bioRxiv - Cancer Biology 2019Quote: ... The concentration and size distribution of Hi-C library DNA after PCR amplification was determined by tapestation (Agilent Technologies), and the Hi-C libraries were sequenced on Illumina Hi-Seq 2500 or Illumina Hi-seq 4000 at 50 cycles.
-
bioRxiv - Physiology 2020Quote: ... 20 μL samples were injected into Hi-Plex H column (300×7.7 mm; 8 μm particle size, Agilent Tech.). 0.1% formic acid in Milli-Q water (Merck Millipore ...
-
bioRxiv - Microbiology 2019Quote: ... The RNA was DNase treated using Turbo DNA free kit according to manufacturer’s protocol (Thermo Fischer scientific) for making cDNA using Accuscript hi-fidelity cDNA synthesis kit (Agilent). The qRT-PCR was set up using brilliant III ultra-fast SYBRgreen qPCR master mix in Mx3005P qPCR system Agilent ...
-
bioRxiv - Genetics 2020Quote: ... Synthesis of cDNA was carried out with the AccuScript Hi-Fi cDNA Synthesis Kit (Agilent Technologies, Santa Clara, USA) using Oligo(dT ...
-
bioRxiv - Microbiology 2023Quote: ... PCR amplification of pcDNA3.1-NS3-mCherry-HIS plasmid was done by using PfuUltra HotStart DNA Polymerase (Agilent, Cat #: 600390) and forward and reverse primers (table 2 ...
-
Sex Differences in Brain Tumor Glutamine Metabolism Reveal Sex-Specific Vulnerabilities to TreatmentbioRxiv - Cancer Biology 2021Quote: Derivatized samples were run on an Agilent 7890A GC coupled to an Agilent 5975C MS and data was acquired and analyzed in MSD ChemStation E.02.02.1431 (Agilent). The GC temperature program was set to ...
-
bioRxiv - Cell Biology 2021Quote: ... cells were resuspended in DMEM with 10% of FCS and transferred into xCELLigence microplates (E-plate 16, Agilent) at the density of 20 000 cells for real-time analysis of cell adhesion and growth ...
-
bioRxiv - Cancer Biology 2022Quote: ... and fixed with precooled methyl alcohol in −20℃ for 30 min followed by H&E staining (Eosin, Dako CS701 ...
-
Sex Differences in Brain Tumor Glutamine Metabolism Reveal Sex-Specific Vulnerabilities to TreatmentbioRxiv - Cancer Biology 2021Quote: Derivatized samples were run on an Agilent 7890A GC coupled to an Agilent 5975C MS and data was acquired and analyzed in MSD ChemStation E.02.02.1431 (Agilent). The GC temperature program was set to ...
-
bioRxiv - Neuroscience 2022Quote: ... Derivatized samples were run on an Agilent 7890A GC coupled to an Agilent 5975C MS and data was acquired and analyzed in MSD ChemStation E.02.02.1431 (Agilent). The GC temperature program was set to ...
-
bioRxiv - Systems Biology 2023Quote: ... The cells were plated at 15,000 cells/well onto fibronectin-coated (5 μg/cm2) xCELLigence E-plate (Agilent) wells in serum free medium ...
-
bioRxiv - Cancer Biology 2023Quote: ... 30,000 LM7 or LM7-KO cells were added to each well of a 96 well E-Plate (Agilent) in complete RPMI ...
-
bioRxiv - Cancer Biology 2022Quote: ... All tissue slices were routinely stained with hematoxylin and eosin (H&E) using the Dako Coverstainer (Agilent Technologies) and were reviewed by an experienced pathologist ...
-
bioRxiv - Microbiology 2023Quote: Cells were seeded at 3,000 cells/well in 150 μL of complete media (above) in E-plates (Agilent) and grown overnight while being monitored with an xCELLigence SP system (Agilent) ...
-
bioRxiv - Plant Biology 2023Quote: ... Raw GC/MS files were exported to NetCDF format using Agilent MSD ChemStation software (Revision E.02.01.1177; Agilent Technologies ...
-
bioRxiv - Bioengineering 2023Quote: ... ITO slides were then stained for H&E and imaged using the Cytation 5 (Agilent, Santa Clara, CA) and Epsilon scanner at 3000 dpi to select regions of interest using the open-source program ...
-
bioRxiv - Neuroscience 2023Quote: ... followed by staining with hematoxylin and eosin (H&E) (Eosin, Dako CS701, Hematoxylin Dako S3309, bluing buffer CS702). The brightfield images were taken on a Leica DMI8 whole-slide scanner at 10x resolution.
-
bioRxiv - Plant Biology 2021Quote: ... The absorbance spectra of (de)protonated species in solution were measured from 260 – 800 nm using a Cary 5000 UV-Vis.-NIR spectrophotometer (Agilent, Santa Clara USA) prior to any fluorescence analysis ...
-
bioRxiv - Pathology 2020Quote: ... Cambridge, MA), CD68 (LV n=25, IVS n= 26, RV n=22) for macrophages (1:800, clone KP1, Dako/Agilent, Santa Clara, CA), and CD163 (LV n=26 ...
-
bioRxiv - Cell Biology 2019Quote: ... Protein lysates were incubated at 4°C with a mouse monoclonal antibody directed against the FLAG-tag (M2, Stratagene). Immunocomplexes were pulled down by incubation with protein G sepharose ...
-
bioRxiv - Plant Biology 2019Quote: ... Extracts were derivatized using an AccQ•Tag Ultra Derivatization Kit (Waters Corp.) according to the manufacturer’s protocol and analyzed using an HPLC (Agilent) coupled to a mass spectrometer (4500 QTRAP (Sciex) ...
-
bioRxiv - Neuroscience 2019Quote: ... of the canonical 307 amino acid human NMNAT2 variant (NCBI ProteinID: NP_055854) cloned in expression vector pCMV Tag-2B (Stratagene). A short linker (17 amino acids ...