Labshake search
Citations for Thermo Fisher :
351 - 400 of 919 citations for Universal TT epitope P2 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2020Quote: ... 5 µL of Taqman Universal PCR mix (Applied Biosystems, Foster City, CA), 0.3 µM of forward primer ...
-
bioRxiv - Neuroscience 2022Quote: ... or a universal negative control (SIC001) with Lipofectamine RNAiMax transfection reagent (ThermoFisher), according to the manufacturer’s recommendations ...
-
bioRxiv - Neuroscience 2022Quote: ... The cDNAs were mixed with TaqMan Universal PCR master mix (Life Technologies) and amplified using an ABI PRISM 7900HT sequence detection system (Applied Biosystems) ...
-
bioRxiv - Physiology 2022Quote: ... cDNA was amplified using a TaqMan Universal PCR Master Mix (Applied Biosystems). Relative quantification was carried out using the delta-delta Ct method ...
-
bioRxiv - Neuroscience 2022Quote: ... qPCR was performed using either Taqman Universal PCR Master Mix (Thermo Fisher) for microRNA detection ...
-
bioRxiv - Cell Biology 2022Quote: ... After treatment with Pierce Universal Nuclease (Thermo Fisher Scientific, 1:1000 dilution) for 5 minutes at room temperature ...
-
bioRxiv - Physiology 2022Quote: ... 2X TaqMan Universal Master Mix (Applied Biosystems, TaqMan® Gene Expression Systems), and cDNA template ...
-
bioRxiv - Developmental Biology 2022Quote: ... qPCR was performed using TaqMan Fast Universal PCR Master Mix (ThermoFisher, #364103). cDNA was diluted 1/16 and 4 μl of diluted cDNA was used in a 10 μl qPCR reaction ...
-
bioRxiv - Bioengineering 2022Quote: ... 0.1 mL/mL Pierce universal nuclease (Thermo Fisher Scientific, Waltham, MA, USA), and 0.1% w/v Triton X at final concentration ...
-
bioRxiv - Neuroscience 2023Quote: ... qRT-PCR reactions were carried out using Universal SSA SYBR Green (ThermoFisher) on a CFX384 qPCR System (Bio-Rad) ...
-
bioRxiv - Physiology 2023Quote: ... while the TaqMan Universal Master Mix II was purchased from Applied Biosystems. The relative amounts of mRNA were normalized to Rn18s and the fold change of gene expression was calculated using the 2(-ΔΔCt ...
-
bioRxiv - Cell Biology 2023Quote: qPCR was performed using TaqMan Fast Universal PCR Master Mix (Thermofisher, 4352042) and Taqman probes and primers for G0S2 (Thermofisher ...
-
bioRxiv - Cell Biology 2023Quote: ... After treatment with Pierce Universal Nuclease (Thermo Fisher Scientific, 1:1000 dilution) for 5 minutes at room temperature ...
-
bioRxiv - Pathology 2023Quote: ... which was performed using the TaqMan Universal PCR Master Mix (Applied Biosystems) and specific TaqMan probes (Applied Biosystems) ...
-
bioRxiv - Plant Biology 2023Quote: ... The TaqMan Universal PCR master mix (Thermo Fisher Scientific, Waltham, MA, USA) with 16S rRNA gene primer and probe sets (Hosseinzadeh et al ...
-
bioRxiv - Cancer Biology 2022Quote: ... and TaqMan® Universal PCR Master Mix (Life Technologies, Carlsbad, CA, USA) in a LightCycler® system (Roche Life Science ...
-
bioRxiv - Neuroscience 2023Quote: ... for mRNA detection or Taqman Universal PCR Master Mix (Thermo Fisher Scientific). Quantification cycle (Cq ...
-
bioRxiv - Immunology 2023Quote: ... RT-qPCR was performed using TaqMan Universal Master Mix (Applied Biosystems, 4304437) with specific TaqMan probes to quantify COLEC11 (Hs00388161_m1) ...
-
bioRxiv - Molecular Biology 2023Quote: ... in 25 μL reaction using Taqman Universal Mastermix (Applied Biosystems, Carlsbad, CA) with 100 ng genomic DNA ...
-
Linear ubiquitination at damaged lysosomes induces local NF-κB activation and controls cell survivalbioRxiv - Cell Biology 2023Quote: ... 1 mM phenylmethylsulfonyl fluoride and Pierce Universal Nuclease (Thermo Fisher Scientific, 88701). Cells were lysed with RIPA lysis buffer for 20 min on ice ...
-
bioRxiv - Cancer Biology 2023Quote: ... using TaqMan probes and TaqMan Universal PCR Master Mix (Applied Biosystems, 4326708). TaqMan probes are listed in Supplementary Table 1.
-
bioRxiv - Genetics 2021Quote: ... aliquots of a custom-made rabbit anti-NHE6 antibody (C-terminal epitope: GDHELVIRGTRLVLPMDDSE, Covance #048) (Ouyang et al., 2013) were conjugated to Dynabeads Protein G (Thermo Fisher #10004D) at room temperature for 2 h according to the manufacturer’s instructions ...
-
bioRxiv - Systems Biology 2020Quote: ... Constructs containing the gene of interest fused to the biotin ligase and a FLAG epitope were generated via Gateway cloning technology (Thermo Fisher Scientific). Firstly ...
-
bioRxiv - Biochemistry 2021Quote: ... of a test GPCR with N-terminal HA-derived signal sequence and FLAG-epitope tag followed by a flexible linker (MKTIIALSYIFCLVFADYKDDDDKGGSGGGGSGGSSSGGG; ssHA-FLAG-GPCR) in 200 μl of Opti-MEM (Thermo Fisher Scientific). To measure dissociation of the other G-protein families ...
-
bioRxiv - Microbiology 2022Quote: APEX2 coding sequence (56) with the FLAG epitope at the N-terminus optimized for expression in human cells was synthesized by Invitrogen (GeneArt service). For the transient expression ...
-
bioRxiv - Cancer Biology 2022Quote: ... tissues were deparaffinized and pre-treated with the Epitope Retrieval Solution [ER1 Citrate Buffer for Ki-67 (dilution 1:200, clone SP6, Thermo Fisher Scientific) and F4/80 (dilution 1:200 ...
-
bioRxiv - Microbiology 2021Quote: ... Permeabilized cells were probed with a monoclonal antibody against the HA-tag epitope (1:1000; HA Tag mAb 2-2.2.14, Thermo Fisher Scientific, Planegg, Germany) to detect SARS-2-S protein ...
-
bioRxiv - Cell Biology 2023Quote: ... magnetic beads bound to antibody recognizing the FLAG epitope tag were prepared in-house by coupling Dynabeads M-70 Epoxy (Thermo Fisher Scientific) to FLAG M2 antibody (Millipore Sigma) ...
-
bioRxiv - Neuroscience 2023Quote: ... and masked epitopes were recovered with eBioscience™ IHC Antigen Retrieval Solution - High pH (10X) (Invitrogen, Waltham, MA, USA, #00-4956-58). Slides were blocked for 1 hour at room temperature with blocking solution (1xPBS ...
-
bioRxiv - Immunology 2023Quote: ... anti-SIVmac251 Nef mAb (clone 17, epitope peptide corresponding to SIVmac239 Nef 71-80 not including the residue G63: Thermo Scientific/Pierce) manually conjugated with Alexa 488 or Alexa 647 ...
-
bioRxiv - Immunology 2023Quote: ... was PCR amplified using primers listed in Table S2 and flanked with the HA epitope coding sequence before the stop codon followed by cloning into pcDNA3.1+ (Thermo Scientific, Cat# V79020) between KpnI and EcoRI sites ...
-
bioRxiv - Pathology 2023Quote: ... were subjected to a heat-induced epitope retrieval procedure and then immunohistochemically stained with polyclonal antibodies to CD45 (#PA5-11671, Thermo Fisher Scientific), COL14A1 (#PA5-49916 ...
-
bioRxiv - Immunology 2021Quote: ... All qPCR reactions were prepared with Taqman Universal MasterMix II (Applied Biosystems, 4440038) and were analyzed with Applied Biosystems QuantStudio ViiA 7 analyzer.
-
bioRxiv - Neuroscience 2021Quote: ... qPCR was performed using TaqMan™ Universal Master Mix II (Thermo Fisher Scientific4440040), using 1 μL of 20X TaqMan gene-specific expression assay to the reaction and our probes of interest (Thermo Fisher Scientific ...
-
bioRxiv - Genomics 2020Quote: ... cDNA was amplified using Taqman Universal Master Mix with UNG (Thermo Fisher Scientific) along with probes for TUBB ...
-
bioRxiv - Cancer Biology 2020Quote: ... converted to cDNA and analyzed by qPCR using Universal PCR mastermix (Life Technologies) according to manufacturer’s instructions ...
-
bioRxiv - Genomics 2020Quote: ... A 10µl PCR reaction contained TaqMan Fast Universal PCR mastermix (ThermoFisher Scientific, 4366072), 0.1 μM Universal probe library hydrolysis probe ...
-
bioRxiv - Molecular Biology 2019Quote: ... Quantitative PCR reactions were run with Fast Universal PCR master mix (#4352042, ThermoFisher) in a Bio-Rad CFX384 system (Koon et al. ...
-
bioRxiv - Physiology 2019Quote: ... 25 ng of cDNA was mixed with 1X TaqMan Universal Master Mix (Invitrogen) and 1 µL of either dystrophin (Dmd ...
-
bioRxiv - Physiology 2019Quote: ... Total reaction volumes used were 10ul containing Taqman Universal PCR mix (Applied Biosystems). All reactions were normalised to 18s rRNA (VIC ...
-
bioRxiv - Cancer Biology 2021Quote: ... mRNA level was assessed using the TaqMan Universal PCR Master Mix (Applied Biosystems) with the sequence-specific probes DHODH (Hs00361406_m1) ...
-
bioRxiv - Microbiology 2021Quote: DNA was extracted from whole blood using MagVet universal isolation kit (Life Technologies), at different days throughout the study ...
-
bioRxiv - Microbiology 2021Quote: ... qRT-PCR was performed with the TaqMan Universal Master Mix (Applied Biosystems #4440038), and TaqMan primer/probe sets for each gene of interest (MX1 ...
-
bioRxiv - Cancer Biology 2020Quote: ... TaqMan microRNA assays and TaqMan 2X Universal PCR Master Mix (Applied Biosystems, UK) were used ...
-
bioRxiv - Molecular Biology 2022Quote: ... qPCR reactions were performed using TaqMan Universal PCR Master Mix (Thermo Fisher Scientific) and the StepOnePlus Real-Time PCR System (Applied Biosystems ...
-
bioRxiv - Genetics 2022Quote: ... Allele specific expression levels were determined using TaqMan Universal Master Mix II (ThermoFisher), and TaqMan genotyping probes for rs1108842 (Applied Biosystems) ...
-
bioRxiv - Immunology 2020Quote: ... qPCR was performed using TaqMan primers and TaqMan Universal Master Mix (Applied Biosystems) for the following genes ...
-
bioRxiv - Developmental Biology 2022Quote: ... Gene expression was assessed using TaqMan Fast Universal PCR Master Mix (Applied Biosystems) and analyzed on a Step-One Plus instrument (Applied Biosystems) ...
-
bioRxiv - Microbiology 2021Quote: ... Quantitative PCRs (qPCRs) were performed using the Taqman universal PCR mastermix (Applied Biosystems) as instructed in the manufacturer’s protocol and each of the sample-target combinations were assayed in duplicate ...
-
bioRxiv - Developmental Biology 2019Quote: ... qPCR was performed with TaqMan universal PCR master mix (Thermo Fisher Scientific, 4304437) on the Applied Biosystems Quant Studio 3 RT PCR system ...