Labshake search
Citations for Thermo Fisher :
2051 - 2100 of 3952 citations for Rubella Virus VLP strain F Therien since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2023Quote: ... F-actin and nuclei were stained using Oregon Green 488-conjugated phalloidin (1:200; ThermoFisher) and Hoechst (1:1000 ...
-
Glioblastoma cells use an integrin- and CD44-mediated motor-clutch mode of migration in brain tissuebioRxiv - Cancer Biology 2023Quote: ... 5% CO2 incubator with Dulbecco’s modified Eagle’s medium/F-12 (31765-035; Gibco, Gaithersburg, MD) with 8% fetal bovine serum (10438-026 ...
-
bioRxiv - Cancer Biology 2023Quote: ... TrypLE reaction was quenched via dilution with cold Splitting Media (Advanced DMEM/F-12 [Gibco] ...
-
bioRxiv - Bioengineering 2023Quote: ... Dulbecco’s Modified Eagle Medium/Nutrient Mixture F-12 (DMEM/F12 Thermo Fisher Scientific, MA, USA) supplemented with 10% fetal bovine serum (FBS ...
-
bioRxiv - Biochemistry 2023Quote: ... hTERT RPE-1 cells (ATCC CRL-4000) were cultured in DMEM/F-12 (Gibco 11330032) with 10% fetal bovine serum (Gibco 16050122 ...
-
bioRxiv - Physiology 2023Quote: ... cells were suspended in DMEM/F-12 media supplemented with GlutaMAX™ (Gibco, Invitrogen, UK). This media was further supplemented with 10% fetal bovine serum (FBS) ...
-
bioRxiv - Genomics 2024Quote: ... For three days cells were cultured in KnockOut DMEM/F-12 (Life Technologies, 12660-012) medium supplemented with 2 µg/mL doxycycline (Sigma-Aldrich ...
-
bioRxiv - Molecular Biology 2024Quote: ... Secondary antibody anti-rabbit Alexa Fluor 488 F(ab’)2 (A11070, Invitrogen, dilution 1:500) in PBS-Tx supplemented with 1% BSA was incubated overnight at room temperature ...
-
bioRxiv - Immunology 2024Quote: ... The goat anti-mouse FITC labeled F(ab’)2 secondary antibody was purchased from Invitrogen.
-
bioRxiv - Bioengineering 2024Quote: ... 44.5 µL Pluronic F-127 (20% w/v solution in DMSO, Thermo Fisher Scientific Inc) is added to the stock solution for assisting the dispersion of the nonpolar AM ester ...
-
bioRxiv - Bioengineering 2024Quote: ... was coated with 1 mL of 5% Pluoronic F-68 (Gibco, Waltham, MA, USA; 24040032) and incubated for 30 minutes at room temperature before replacement with PBS for storage ...
-
bioRxiv - Cancer Biology 2024Quote: ... MDA-MB-468 cell lines were cultured in DMEM/F-12 media (1:1; Gibco) and supplemented with FBS (10% ...
-
bioRxiv - Cancer Biology 2024Quote: ... SUM159 cells were grown in HAM’S F-12 media (Catalog No. 31765035, Thermo Fisher Scientific) supplemented with 5% FBS ...
-
bioRxiv - Cancer Biology 2024Quote: ... in complete media composed of Advanced DMEM/F-12 (REF 12-634-010, Fisher Scientific), Pen/strep 1% (REF 15-140122 ...
-
bioRxiv - Immunology 2024Quote: ... and enzymatically dissociated in Ham’s F-10 (Hyclone) supplemented with 10% horse serum (Life Technologies), 100 units/ml penicillin and 100 µg/ml streptomycin (Omega Scientific ...
-
bioRxiv - Immunology 2024Quote: ... Peroxidase (HRP)-conjugated goat anti-mouse IgG F(ab’)2 specific antibody was from ThermoFisher Scientific/Pierce (Cat#31436) ...
-
bioRxiv - Immunology 2024Quote: ... DAPI and Phalloidin conjugated with AF594 (for F-actin staining, Thermo Fisher Scientific, Waltham, MA) for 1 hour at room temperature ...
-
bioRxiv - Neuroscience 2024Quote: ... NMM was prepared using 1:1 DMEM/F-12 GlutaMAX:Neurobasal (Gibco/Thermo-Fisher, Waltham, MA), 1x N2 supplement (Gibco) ...
-
bioRxiv - Immunology 2024Quote: ... Biopsy bites were immediately placed into Advanced DMEM F-12 media (Gibco, catalog number 11320033), placed on wet ice for transport ...
-
bioRxiv - Genomics 2024Quote: ... were cultured in 1:1 Dulbecco’s Modified Eagle’s Medium: Ham’s F-12 (Gibco, #11330-032), supplemented with 5% Horse Serum ...
-
bioRxiv - Developmental Biology 2024Quote: ... and F-actin was stained with either Alexa Flour 488-labelled phalloidin (Invitrogen, 1:1000) or Alexa Flour 633-labelled phalloidin (Invitrogen ...
-
bioRxiv - Microbiology 2024Quote: SV-HUC-1 cells were cultured at 37 °C in Ham’s F-12K medium (Gibco) containing 10% fetal bovine serum (FBS ...
-
bioRxiv - Developmental Biology 2021Quote: Escherichia coli (E. coli) strain DH5α (Toyobo, Osaka, Japan) and BL21(de3) pLysS (C606003, ThermoFisher Scientific) were used for DNA cloning and protein expression ...
-
bioRxiv - Molecular Biology 2021Quote: ... Genomic DNA of the test strains was digested by NotI restriction enzyme (Gibco-BRL, Gaithersburg, MD) and Salmonella enterica serovar Braenderup was digested using XbaI ...
-
bioRxiv - Developmental Biology 2020Quote: RNA was collected from indicated strains as well as from RNAi treatments using TRIZOL Reagent (Invitrogen). Three biological replicates ...
-
bioRxiv - Molecular Biology 2021Quote: RNA from indicated strains was extracted from mixed stage populations of animals using TRIzol reagent (Invitrogen), then alcohol precipitated ...
-
bioRxiv - Biochemistry 2020Quote: ... Saccharomyces cerevisiae strain InvSc1 (MATa adc2-1 his3-11,15 leu2-3,112 trp1-1 ura3-52; Invitrogen) was grown in synthetic dextrose medium (5 mL ...
-
bioRxiv - Cancer Biology 2020Quote: ... The ligated vectors were transformed into Stbl3 strain of Escherichia coli (Thermo Fisher Scientific, Waltham, MA) and selected with 100 µg/mL ampicillin on LB/agar plates ...
-
bioRxiv - Biophysics 2021Quote: ... ZIKV strain UniProt ID: A0A024B7W1) (NH2-AARAAQKRTAAGIMKNPVVDGIVVTDIDMTIDPQVEKK-COOH) with 96% purity was purchased from Thermo scientific USA and dissolved in buffer consisting of 20 mM sodium phosphate buffer (pH 7.4) ...
-
bioRxiv - Microbiology 2020Quote: ... The purified plasmids harboring the genes of interest were transformed into yeast strain INVSc1 (ThermoFisher Scientific) for protein expression and purification ...
-
bioRxiv - Cell Biology 2021Quote: Leishmania mexicana (MNYC/BZ/62/M379) derived strains were grown at 25°C in HOMEM (Gibco) supplemented with 10% (v/v ...
-
bioRxiv - Biophysics 2020Quote: ... Freshly prepared competent cells of a strain of Pichia pastoris SMD 1163 (Δhis4 Δpep4 Δprb1, Invitrogen) were electro-transformed with individually PmeI-HF (New England Biolabs ...
-
bioRxiv - Developmental Biology 2022Quote: Mouse zygotes (C57BL6/N strain) were injected with 200 ng/µL Cas9 protein (IDT and ThermoFisher), 100 ng/µL Fzd2-specific sgRNA (GCAAGACACTGCACTCGTGG) ...
-
bioRxiv - Genomics 2022Quote: ... vector and amplified in DH5α strain of Escherichia coli (E coli) (Life Technologies, Grand Island NY). After amplification ...
-
bioRxiv - Microbiology 2021Quote: ... coli strains were grown for 24 h at 37°C in 10 mL DMEM-HEPES (Gibco), resuspended in 500µL HBSS (Invitrogen ...
-
bioRxiv - Biophysics 2020Quote: Plasmodium falciparum strains W2 and 3D7 were cultured in 50 mL flasks containing RPMI (Thermo Fisher #31800089 ...
-
bioRxiv - Plant Biology 2019Quote: ... coli strain K12 with JCAT (Grote et al., 2005) (http://www.jcat.de/) and synthesized by Thermo Fisher Scientific (Table S3) ...
-
bioRxiv - Biochemistry 2021Quote: ... pastoris strain GS115 and the Pichia expression vector (pPIC9K) were obtained from Invitrogen (Carlsbad, CA, USA). Bovine trypsin ...
-
bioRxiv - Synthetic Biology 2021Quote: HEK293T cells (ATCC, strain number CRL-3216) were maintained in Dulbecco’s modified Eagle medium (DMEM, Gibco) supplemented with 10% FBS (Sigma-Aldrich) ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified total RNA for each strain used in Affymetrix GeneChip assays (Affymetrix GeneChip Rat Gene 1.0). Microarrays were processed using an Agilent GeneArray Scanner with Affymetrix Microarray Suite version 5.0.0.032 software.
-
bioRxiv - Synthetic Biology 2021Quote: HEK293T cells (ATCC, strain number CRL-3216) were cultured in Dulbecco’s modified Eagle’s medium (DMEM; Gibco) supplemented with 10 % FBS (Sigma-Aldrich) ...
-
bioRxiv - Cell Biology 2021Quote: ... All HTM cell strains were validated with dexamethasone (DEX; Fisher Scientific, Waltham, MA, USA; 100 nM) induced myocilin (MYOC ...
-
bioRxiv - Developmental Biology 2021Quote: Escherichia coli (E. coli) strain DH5α (Toyobo, Osaka, Japan) and BL21(de3) pLysS (C606003, ThermoFisher Scientific) were used for DNA cloning and protein expression ...
-
bioRxiv - Microbiology 2020Quote: ... DNA samples from each strain were extracted using a MAGnify Chromatin Immuno-precipitation System (Invitrogen, USA) according to the manufacturer’s protocol with a modification ...
-
bioRxiv - Microbiology 2021Quote: ... Indicated strains were inoculated to an OD600 of 0.1 in 25 mL CO2-independent medium (Gibco) or 25 mL CO2-independent medium supplemented with 250 μM BCS and cultivated for 3d at 37°C ...
-
bioRxiv - Immunology 2020Quote: ... Both RSV strains were propagated on HEp-2 cells (ATCC, CCL-23) cultured in DMEM (Gibco) supplemented with 5% FBS (Gibco) ...
-
bioRxiv - Immunology 2022Quote: Listeria monocytogenes EGD (BUG600 strain) was grown in brain heart infusion (BHI) broth (#10462498, Fisher Scientific) shaking at 37□°C ...
-
bioRxiv - Genomics 2022Quote: The 42 Kluyveromyces lactis strains were inoculated into flat bottom 96-well microplates (Nunclon, Thermo Fisher) containing 150 μL of YPD (Yeast extract 1% Peptone 2% Dextrose 2% ...
-
bioRxiv - Microbiology 2022Quote: ... coli XL1-Blue strain cultured in Luria-Bertani (LB) broth (Thermo Fisher Scientific, Waltham, MA, USA) aerobically at 37°C ...
-
bioRxiv - Microbiology 2022Quote: ... The strain was maintained in complete 7H9 media supplemented with 30 μg/ml kanamycin (Fisher Scientific). Mtb mc26206 expressing tdTomato (Mtb-RFP ...