Labshake search
Citations for New England Biolabs :
6101 - 6150 of 9360 citations for Rat CD325 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Evolutionary Biology 2020Quote: ... and prepared DNA-Seq libraries from 100 ng DNA using the NEBNext Ultra II FS DNA Library Prep Kit for Illumina (New England Biolabs; 12 minutes enzymatic shearing ...
-
bioRxiv - Genomics 2021Quote: ... or the NEBNext Ultra II DNA Library Prep Kit for Illumina and NEBNext Multiplex Oligos for Illumina (both New England Biolabs).
-
bioRxiv - Cancer Biology 2020Quote: ... cDNA was synthesized using 200 ng total RNA with the ProtoScript® First Strand cDNA Synthesis kit (New England Biolabs) utilizing random hexamers ...
-
bioRxiv - Genomics 2021Quote: ... RNA was extracted from adult prothoracic leg tissue tissue using Monarch Total RNA Mini Kit (New England Biolabs, Ipswich, MA). Paired-end RNA-Seq libraries were constructed with NEBNext Ultra II Directional RNA prep (New England Biolabs ...
-
bioRxiv - Immunology 2021Quote: ... cDNA was generated using the SuperScript IV reverse transcriptase kit (TFS) and PCR carried out using Q5 High-Fidelity 2X Master Mix (New England Biolabs) as per manufacturer’s instructions ...
-
bioRxiv - Pathology 2021Quote: ... β-ENaC/SCNN1B (Hs00165722_m1) and γ-ENaC/SCNN1G (Hs00168918_m1) were performed with the Luna Universal Probe One-Step RT-qPCR Kit (NEB, E3006L). Expression of each gene was normalized to 18S (Hs99999901_s1) ...
-
bioRxiv - Plant Biology 2020Quote: T-DNAs expressing four sgRNAs were assembled from BsaI-linearized vectors and three PCR fragments using an NEBuilder kit (E2621, New England Biolabs). Appropriate PCR fragments were generated in three- or four-primer reactions similar to the ones described above ...
-
bioRxiv - Plant Biology 2020Quote: ... PolyA enrichment and library preparation were performed with the NEBNext Ultra Directional RNA Library Prep Kit for Illumina (New England Biolabs). Libraries were quantified by fluorometry ...
-
bioRxiv - Plant Biology 2020Quote: ... The resulting fragments were gel-purified with the QIAquick Gel Extraction Kit and ligated using T4 DNA Ligase (New England Biolabs) into dephosphorylated pBlueScript KS+ that had also been digested with NotI and gel-purified to make pBS-SS-TOM ...
-
bioRxiv - Microbiology 2021Quote: ... or 230 nucleotides (rLLOV-ZsG-IRins-MARVUTR+tr) were excised and purified via Monarch DNA Gel Extraction Kit (New England Biolabs) according to the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2021Quote: ... and TruSeq-barcoded RNAseq libraries were generated with the NEBNext Ultra II Directional RNA Library Prep Kit (New England Biolabs). Sequencing was performed at the Cornell University Transcriptional Regulation and Expression Facility on a NextSeq500 instrument (Illumina ...
-
bioRxiv - Physiology 2021Quote: ... Three mRNA-seq libraries per condition were prepared using the NEBNext Ultra II directional RNA library Prep kit for Illumina (New England Biolabs), and read in paired-end 40-cycle sequencing runs on the NextSeq 500 system (Illumina) ...
-
bioRxiv - Synthetic Biology 2021Quote: ... Genetic parts were amplified using primers listed in Table S1 and PCR products were purified with the Monarch PCR & DNA Clean up kit (NEB). Parts were assembled into plasmid constructs mainly by Gibson assembly [41] using the isothermal method ...
-
bioRxiv - Microbiology 2021Quote: ... was utilized using SARS-CoV-2 specific primers[43] or SARS-CoV-2 Rapid Colorimetric LAMP Assay Kit (New England Biolabs), which became available in assays after September 15 ...
-
bioRxiv - Microbiology 2020Quote: ... metagenomic libraries were prepared using NEBNext® Ultra™ II DNA Library Prep Kit (New England Biolabs, Cat. No. E7645) according to manufacturer’s instructions ...
-
bioRxiv - Cancer Biology 2020Quote: Sequencing libraries were generated by the Genome Analysis and Technology Core at University of Virginia using oligo dT-purified mRNA from 500ng of total RNA and the NEB Next Ultra RNA library preparation kit (New England Biolabs), and 50-bp single-end sequencing was performed on Illumina NextSeq 500 platform (Illumina) ...
-
bioRxiv - Cell Biology 2021Quote: ... The final amplicon was purified from genomic DNA using a Monarch PCR and DNA Cleanup Kit (New England Biolabs T1030) and quantified with a Qubit 2.0 Fluorometer ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... A library with 300-400 bp insert size for each pool was prepared using NEBNext Ultra II DNA Library Prep Kit (New England Biolabs). Libraries were then sequenced with 150 bp paired-end on the HiSeq X Ten platform.
-
bioRxiv - Cancer Biology 2021Quote: ... mutant at A573D of AR-fl and AR-V7 in the pEGFP-C1 backbone were generated by site-directed mutagenesis using the Q5 site-Directed Mutagenesis Kit (New England BioLabs). The dimerization box (D-box ...
-
Safety and efficacy of C9ORF72-repeat RNA nuclear export inhibition in amyotrophic lateral sclerosisbioRxiv - Systems Biology 2021Quote: ... Dual-indexed strand-specific RNA-seq library were prepared from the submitted total RNA samples using RiboZero rRNA depletion and the NEBNext Ultra Directional RNA library preparation kits (New England Biolabs). Paired-end 2×150bp sequencing was performed on an Illumina HiSeq 4000 platform ...
-
bioRxiv - Biochemistry 2021Quote: ... which we used to construct the D614G mutant via site directed mutagenesis (Q5 Site-Directed Mutagenesis Kit, New England Biolabs).
-
bioRxiv - Biochemistry 2021Quote: ... K4A with K3WA) mutants of the full-length RAD51AP1 protein were generated by Q5 Site-Directed Mutagenesis kit (New England Biolabs) following the instructions of the manufacturer and the primer pairs listed in Table 1.
-
bioRxiv - Biochemistry 2020Quote: ... The mRNA was then adapter ligated and prepared for Illumina sequencing using the Ultra Directional RNA Library Prep Kit (NEB).
-
bioRxiv - Bioengineering 2021Quote: ... the reporter gene GFP was replaced with mScarlet using the NEBuilder HiFi DNA Assembly kit (New England BioLabs catalog number:E5510S), to produce two different expression vectors.
-
bioRxiv - Bioengineering 2021Quote: Sense RNA fragments and and circular adRNA were made by in vitro transcription using the HiScribe T7 Quick High Yield RNA Synthesis Kit (NEB) as per the manufacturer’s protocol ...
-
bioRxiv - Bioengineering 2021Quote: ... were either synthesized or PCR-amplified and then cloned into the px552-U6-CAG-mCherry plasmid using an NEBuilder HiFi DNA assembly kit (NEB). The AAV vectors were then sent to VectorBuilder Inc (Chicago ...
-
bioRxiv - Bioengineering 2021Quote: ... were PCR-amplified using primers listed in Supplementary Table 7 and cloned into the px601 plasmid using an NEBuilder HiFi DNA assembly kit (NEB). Similarly ...
-
bioRxiv - Bioengineering 2021Quote: ... were synthesized using a T7 RNA polymerase in vitro transcription with the HiScribe T7 ARCA mRNA Kit (with tailing) (NEB). The mRNAs were purified using a Monarch RNA Cleanup Kit (NEB) ...
-
bioRxiv - Bioengineering 2020Quote: ... We added 1 μL of the resulting DNase digestions to 10 μL RT-qPCR reactions (Luna One-Step Universal RT-qPCR Kit, New England Biolabs) containing 0.8 U/μL RNasin Plus (Promega ...
-
bioRxiv - Bioengineering 2020Quote: ... We performed assays for the E and RNase P genes separately in 20 μL reaction volumes using the Luna Universal Probe One-Step RT-qPCR Kit (New England Biolabs). The final concentrations of primer and probe were 400 and 200 nM ...
-
bioRxiv - Biochemistry 2020Quote: ... Libraries were prepared using the NEBNext Ultra II DNA Library Prep Kit for Illumina (New England BioLabs, Ipswich, MA, USA). Paired-end 100bp reads were performed on an Illumina HiSeq4000 ...
-
Long-Range Electrostatic Interactions Significantly Modulate the Affinity of Dynein for MicrotubulesbioRxiv - Biophysics 2021Quote: ... We mutated aspartic acid 3420 to alanine (D3420A) and glutamic acid 3320 to alanine (E3320A) using a Q5 site-directed mutagenesis kit (E0552S, New England Biolabs, Ipswich ...
-
bioRxiv - Microbiology 2021Quote: ... RNA was eluted in RNase-free water and subsequently treated with Turbo DNase and purified using the Monarch RNA Cleanup Kit (50 µg) (NEB) and eluted in RNase-free water ...
-
bioRxiv - Neuroscience 2020Quote: ... Total RNA was extracted from the heads of 20 male adults or 17 female adults using a Monarch Total RNA Miniprep Kit (NEB). 3 replicates for male and 3 replicates for female flies were done for each genotype ...
-
bioRxiv - Neuroscience 2020Quote: ... cDNA libraries were made from RNA using NEB’s Next Single Cell/Low Input RNA Library Prep Kit for Illumina (NEB E6420). Libraries were sequenced on an Illumina HiSeq 4000 with single reads of 50 bases.
-
bioRxiv - Microbiology 2021Quote: ... qRT-PCR was performed from 1µL of template RNA in a final volume of 5 μL per reaction in 384-well plates using the Luna Universal Probe One-Step RT-qPCR Kit (New England Biolabs) with SARS-CoV-2 N-specific primers (EV Table 1 ...
-
bioRxiv - Microbiology 2021Quote: ... The amino acid deletions in the full-length SARS-CoV-2 Spike expressor were generated using the Q5 site-directed mutagenesis kit (NEB). The presence of the desired mutations was determined by automated DNA sequencing ...
-
bioRxiv - Molecular Biology 2021Quote: ... cut sites found in the primers and cloned into a pcDNA3.1(+) backbone using the Quick Ligation Kit (New England Biolabs M2200). Plasmids were transformed and grown in subcloning efficiency DH5α competent cells (Invitrogen # 18265017 ...
-
bioRxiv - Plant Biology 2021Quote: ... 1µg of purified DNA was used for in-vitro transcription following the manufacturer instructions (HiScribe T7 High Yield RNA Synthesis Kit, NEB). Purified non-crosslinked chromatin obtained from five grams of MARS RNAi line 1 seedlings were resuspended in 1 mL of nuclei lysis buffer and split into five tubes ...
-
bioRxiv - Cancer Biology 2021Quote: ... Trp53 point mutations were introduced using site-directed mutagenesis with the Q5 Site-Directed Mutagenesis Kit (New England Biolabs E0552S). Retrovirus was produced by plasmid transfection into Platinum-E (Plat-E ...
-
bioRxiv - Cancer Biology 2021Quote: ... This NUP210 insert was then cloned into the Gateway entry vector pENTR1A using the Quick Ligation Kit (New England Biolabs). pENTR1A no ccdB plasmid (Addgene plasmid # 17398 ...
-
bioRxiv - Cell Biology 2021Quote: ... The procedure of the complementary DNA (cDNA) libraries was carried out with NEBNext Ultra II RNA library Prep kit (NEB) and NEBNextplex Oligos for Illumina following a previously described method (Kohno et al. ...
-
bioRxiv - Cell Biology 2021Quote: ... A 12xHis tag was cloned into the N-terminus of pcDNA3.1-MICAL1-FLAG using Q5® Site-Directed Mutagenesis Kits (New England BioLabs) according to the manufacturer’s protocol ...
-
BRD2 inhibition blocks SARS-CoV-2 infection by reducing transcription of the host cell receptor ACE2bioRxiv - Cell Biology 2021Quote: ... PCR was carried out in a final volume of 5 μL per reaction in 384-well plates using the Luna Universal Probe One-Step RT-qPCR Kit (New England Biolabs) with SARS-CoV-2 N-specific primers (Forward 5′-TAA TCA GAC AAG GAA CTG ATT A-3′ ...
-
BRD2 inhibition blocks SARS-CoV-2 infection by reducing transcription of the host cell receptor ACE2bioRxiv - Cell Biology 2021Quote: ... 5′-TAATCAGACAAGGAACTGATTA-3′ (Forward) and 5′-CGAAGGTGTGACTTCCATG-3′ (Reverse) were used with the Luna Universal One-Step RT-qPCR Kit (New England Biolabs) in an Applied Biosystems QuantStudio 6 thermocycler or an Applied Biosystems StepOnePlus system ...
-
BRD2 inhibition blocks SARS-CoV-2 infection by reducing transcription of the host cell receptor ACE2bioRxiv - Cell Biology 2021Quote: ... were amplified in a final volume of 5 μL per reaction in 384-well plates using the Luna Universal Probe One-Step RT-qPCR Kit (New England Biolabs) on a QuantStudio 6 Flex thermocycler ...
-
bioRxiv - Cancer Biology 2020Quote: ... and gKAT7 (A10) was purchased from IDT and cloned into the BsrGI site of pKLV-EF1aGFP using a NEBuilder HiFi kit (NEB), resulting in pKLV-EF1aGFP2AKAT7-W ...
-
bioRxiv - Cancer Biology 2020Quote: ... Libraries were generated using a NEBNext Ultra II DNA Library Prep Kit for Illumina (New England Biolabs, Cat No. E7645), including fragmentation with a Covaris S220 sonic disruptor ...
-
bioRxiv - Cell Biology 2021Quote: ... Libraries were then prepared from 500 ng genomic DNA using the NEBNext Ultra II FS DNA library prep kit for Illumina (New England Biolabs), according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...