Labshake search
Citations for Addgene :
151 - 200 of 1569 citations for Parvalbumin PVALB cDNA ORF Clone Mouse N His tag since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2021Quote: ... PLpro DNA was subcloned into the biGBac vector pLIB [29] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194). Baculoviruses were generated using the EMBacY baculoviral genome [30] in Sf9 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Genomics 2022Quote: ... BPTF BD with an N-terminal 6xHistidine (6His) tag and Tobacco Etch Virus (TEV) Protease cleavage site was from Addgene (plasmid 39111). This was modified using the Q5 Site-directed mutagenesis kit (New England Biolabs [NEB] ...
-
bioRxiv - Microbiology 2022Quote: ... full length 3CLpro coding-sequences with N-terminal 6His tags were synthesized by Integrated DNA Technologies (Coralville, IA) and cloned into pET-28a(+) vector (Addgene, Cambridge, MA). Subsequently ...
-
bioRxiv - Genetics 2021Quote: RPA1 expression constructs were generated as derivatives of a RPA1-WT expression construct pLX304-hRPA1 bearing bearing an N-ter V5 tag (Addgene Plasmid #25890). The R41E ...
-
bioRxiv - Biochemistry 2021Quote: a codon optimised nagK gene from Plesiomonas shigelloides was cloned into the pOPINS3C expression plasmid (N-terminal polyhistidine and SUMO tags; Addgene #41115 (59)) ...
-
bioRxiv - Cell Biology 2023Quote: ... polyspora Hop1319-529 into UC Berkeley Macrolab vectors to generate N-terminal TEV protease-cleavable His6- or His6-maltose binding protein tags (Addgene #29666, 29706). DNA binding mutants of S ...
-
bioRxiv - Biophysics 2024Quote: The gene encoding Mus musculus talin1 rod domain R1-R2 (amino acid 482–786) was cloned between a N-terminal SNAP-tag gene (Addgene, Plasmid #101135) and a C-terminal HaloTag gene (Promega ...
-
bioRxiv - Biochemistry 2024Quote: ... R2 ORFs were cloned into a pET45b vector with N-terminal His14-MBP-bdSUMO tags and C-terminal TwinStrep for bacterial expression (Addgene vector #176534). R2 plasmids were transformed into BL21(DE3 ...
-
bioRxiv - Biochemistry 2021Quote: ... Vector pREXNH3CA used to clone EfrCD in frame with a C-terminal Avi-tag was constructed from pREXNH3 (Addgene #47079) by PCR amplification with 5’ phosphorylated primers pREXNH3(newAvi_5’P)_FW (5’-aga aaa tcg aat ggc acg aaT AAT AAC TAG AGA GCT CAA GCT TTC TTT GA ...
-
bioRxiv - Neuroscience 2023Quote: ... or GFP and Synaptophysin-RFP cDNA (pRVdG-N-P-M-EGFP-SynPhRFP-L, Addgene plasmid #52483), and with these additional plasmids ...
-
bioRxiv - Biochemistry 2024Quote: ... Ttyh1 was expressed from a pLX304 vector after addition of C-terminal Strep and His tags to an existing construct (Addgene #161676, a gift from Mike McManus). To stably express fluorescently tagged Prom1 WT and W795R variants in HeLa cells for live cell imaging ...
-
bioRxiv - Neuroscience 2022Quote: ... mouse Lhx2 cDNA was amplified from TetO-FUW-Lhx2 (Addgene #61537 ...
-
bioRxiv - Molecular Biology 2023Quote: ... untagged mouse cDNA into a pBig1a vector70 (Addgene, Plasmid #80611). These untagged RING1B and BMI1 constructs were used for all experiments presented in this manuscript with the exception for the data presented in Figure 6C ...
-
bioRxiv - Cancer Biology 2024Quote: ... FLAG-tagged mouse Fgfr2 cDNA was cloned into LentiV_Blast (Addgene_111887) using Gibson assembly (NEB).
-
bioRxiv - Cancer Biology 2020Quote: ... Human DLK1 ectodomain expression vector was obtained from Addgene (DLK1-bio-His, RRID:Addgene_51876) (Sun et al. ...
-
bioRxiv - Cell Biology 2020Quote: ... pEZYmyc-HIS (Addgene, #18701) or pDEST-myc ...
-
bioRxiv - Neuroscience 2024Quote: ... his-hOPTN (Addgene, #23053), mOPTN (mouse tissue cDNA) ...
-
bioRxiv - Cell Biology 2024Quote: ... Eps15-GFP-His (Addgene #170860 ...
-
bioRxiv - Cancer Biology 2022Quote: ... ITGA2-HIS (Addgene, #51910), ITGB2-YFP (Addgene ...
-
bioRxiv - Immunology 2021Quote: ... par-5 and his-1 cDNA were subcloned into pCE-BiFC-VN173 and pCE-BiFC-VC155 plasmids (Addgene, Cambridge, MA), which contain the heat shock promoter Phsp-16.41 ...
-
bioRxiv - Neuroscience 2020Quote: ... mouse Neurexin3α-(-S4) (cDNA gift from Ann Marie Craig’s lab) and rat Neurexin3β-(-S4) (cDNA from Addgene plasmid #58269 from Peter Scheiffele’s lab) ...
-
bioRxiv - Bioengineering 2024Quote: ... pET28a-SUMO-SpyTag003 (N-terminal His6 tag-SUMO protein-SpyTag003) was cloned previously by Irsyad Khairil Anuar (University of Oxford) (GenBank and Addgene deposition in progress). pDEST14-SpyCatcher003-TEVs-SpyTag003DA (‘Masked SpyCatcher0003’ ...
-
bioRxiv - Bioengineering 2024Quote: ... pDEST14-SpyCatcher003-TEVs-SpyTag003DA (‘Masked SpyCatcher0003’; N-terminal His6 tag-SpyCatcher003-TEV protease cleavage site-SpyTag003 D117A, GenBank and Addgene deposition in progress) was derived from pDEST14-SpyCatcher003 (GenBank Accession no ...
-
bioRxiv - Systems Biology 2024Quote: ... codon-optimized SLC cDNAs were cloned from pDONR221 gateway entry vectors (https://www.addgene.org/depositor-collections/re-solute/) into doxycycline-inducible lentiviral gateway destination vectors containing C- or N-terminal HA-Twin-Strep® tags (Addgene # 194066, 194065) and stably transduced into KO cell lines ...
-
bioRxiv - Cancer Biology 2024Quote: The wild-type and MARylation site mutated α-tubulin cDNA was amplified from pCDNA3 clones as previously described [12] using primers encoding an N-terminal FLAG epitope tag listed below and cloned into the pINDUCER20 lentiviral doxycycline (Dox)-inducible expression vector (Addgene, 44012; RRID: Addgene_44012).
-
bioRxiv - Biochemistry 2020Quote: ... H-HCF-1) and full length human THAP11 cDNA with carboxy-terminal FLAG tag (Plasmid #28020; F-THAP11) were obtained from Addgene. Vectors containing full length human THAP1 cDNA with carboxy-terminal 1X FLAG tag (THAP1-F ...
-
bioRxiv - Molecular Biology 2020Quote: Human Drosha cDNA with a Flag-tag at the amino-terminus was cloned into pBABE-puro vector (Addgene plasmid#1764) for producing retrovirus of human Drosha wild type (WT) ...
-
bioRxiv - Cell Biology 2023Quote: The human sFLT1-HA plasmid construct created through Gibson cloning of human sFLT1 cDNA into a pcDNA3.1 vector containing a C-terminal HA tag (pcDNA3-ALK2-HA, Addgene 80870). Sequencing validation was performed through Genewiz ...
-
bioRxiv - Microbiology 2020Quote: ... glabrata RAD53 ORF was subcloned into plasmid pCN-EGD2 (obtained from Addgene) downstream of the weak EGD2 promoter 45 ...
-
bioRxiv - Molecular Biology 2021Quote: ... was generated by replacing the eGFP ORF in pcDNA3.1(+) eGFP (Addgene #109020) with mCherry ...
-
bioRxiv - Cell Biology 2021Quote: ... ORF was amplified and subcloned into pLenti-CMV Puro DEST (Addgene #17452). All ORFs were subcloned into pBabe-Puro vector ...
-
bioRxiv - Cell Biology 2023Quote: ... SspB R73Q ORF was amplified from tgRFPt-SspB R73Q plasmid (Addgene #60416) and then subcloned into C2GAPB/pDM335 at the BglII site to generate the optogenetically-recruitable C2GAPB construct ...
-
bioRxiv - Neuroscience 2022Quote: ... the YTHDF2 ORF was PCR amplified from pcDNA-flag-YTHDF2 (Addgene, #52300). The resulting amplicon was digested with AgeI and XbaI and cloned into cut sites upstream of HaloTag insert in pGW1-Halo.
-
bioRxiv - Neuroscience 2022Quote: ... the YTHDF2 ORF was PCR amplified from pcDNA-flag-YTHDF2 (Addgene, #52300). The resulting amplicon was digested with KpnI and SalI and cloned into cut sites upstream of the 2A in the pGW1-2A-GFP vector.
-
bioRxiv - Genetics 2024Quote: ... we interrupted the mCHERRY ORF of pGH044 (Addgene Plasmid #85412, RRID: Addgene_85412). We scanned mCHERRY for “AGGT” stretch and placed the intron between the AG and GT ...
-
bioRxiv - Genetics 2024Quote: ... we interrupted the mCHERRY ORF of pGH044 (Addgene Plasmid #85412, RRID: Addgene_85412). We scanned mCHERRY for “AGGT” stretch and placed the intron between the AG and GT ...
-
bioRxiv - Molecular Biology 2023Quote: ... Our ORF source of Hs455 was the plasmid pRecLV103-GFP-PGBD5 (Addgene plasmid 65409 ...
-
bioRxiv - Cell Biology 2024Quote: ... pENTR2B-EPLINα was LR subcloned with a pDEST-V2-ORF (Addgene 73636) according the manufacturers’ protocol ...
-
bioRxiv - Plant Biology 2024Quote: ... the ORFs were recombined into the bacterial expression vector pDest-566 (Addgene plasmid #11517 was a gift from Dominic Esposito ...
-
bioRxiv - Plant Biology 2024Quote: ... the ORFs were recombined into the pDest-566 bacterial expression vector (Addgene plasmid #11517 was a gift from Dominic Esposito ...
-
bioRxiv - Biochemistry 2024Quote: ... Plasmids for wildtype enzyme open reading frames (ORFs) were purchased from Addgene or DNASU plasmid repository ...
-
bioRxiv - Cell Biology 2023Quote: cDNA sequences encoding N- and C-terminal fragments of Venus were amplified from pCe-BiFC-VN173 (Addgene) and pCe-BiFC-VC155 (Addgene ...
-
bioRxiv - Cell Biology 2021Quote: ... Gateway recombination of the destination vector pLVpuro-CMV-N-APEX2-EGFP with the entry clone pDONR223 LC3B WT (Addgene plasmid # 123072; http://n2t.net/addgene:123072; RRID:Addgene_123072) (94 ...
-
bioRxiv - Cancer Biology 2023Quote: ... from the expression vector pcDNA3.1/Myc-His(-)-HSulf-2 bearing human Sulf-2 cDNA (a gift from Steven Rosen, Addgene plasmid # 13004) (Morimoto-Tomita et al. ...
-
bioRxiv - Microbiology 2020Quote: The SNAP-tag gene was PCR amplified from pSNAP-tag(m) (Addgene #101135) and cloned into pVpr-IN.eGFP(Albanese et al. ...
-
bioRxiv - Biochemistry 2021Quote: Mouse Bpnt2 cDNA was cloned into the pBABE-puro (Addgene #1764) retroviral vector using BamHI and SalI restriction sites ...
-
bioRxiv - Molecular Biology 2023Quote: ... RBM41 C-terminal fragment (259–413) and full-length 65K were cloned into MAC-tag-N vector (Addgene #108078, a gift from Markku Varjosalo) using Gateway cloning as described (Liu et al. ...
-
bioRxiv - Biophysics 2020Quote: ... The homologous recombination donor (HRD) was generated by EGFP tag and Sec61b cDNA (a gift from Dr. Jennifer Lippincott-Schwartz, Addgene #90992) into AAVS1-TRE3G-EGFP (a gift from Su-Chun Zhang ...
-
bioRxiv - Microbiology 2020Quote: Epitope-tagged expression constructs were made by first cloning cDNAs from RAW 264.7 cell RNA into pENTR1a entry vectors with indicated tags (Addgene Plasmid #17396)(Campeau et al. ...
-
bioRxiv - Systems Biology 2021Quote: ... The pMEL16 (His-, Addgene 107922) and p414-TEF1p-Cas9-CYC1t (hereafter referred to as P414 ...