-
No products found
because this supplier's products are not listed.
Aleksei Kuznetsov, et al.,
bioRxiv - Biochemistry 2020
Quote:
Human recombinant ACE2-His protein (Icosagen OÜ, Estonia, cat# P-302-100) and SARS-CoV-2 Spike protein S1 (Icosagen OÜ ...
-
No products found
because this supplier's products are not listed.
Isabella Pallavicini, et al.,
bioRxiv - Immunology 2023
Quote:
... Kappa immunoglobulin (clone R1371, Leinco Technologies) based on the following treatment schedule ...
-
This Fibronectin solution has been purified from human plasma where it is found as a dimer and...
Cat# 5050-1MG,
1 mg, USD $135.0
Ask
Lauren J. Lahey, et al.,
bioRxiv - Biochemistry 2020
Quote:
HEK293 cell lines were seeded in PurCol-coated (Advanced BioMatrix) 6-well plates at 300,000 total cells in 2 mL media one day before transfection ...
-
No products found
because this supplier's products are not listed.
Pavel Shekhtmeyster, et al.,
bioRxiv - Neuroscience 2021
Quote:
... This vector was co-transfected into HEK293-AAV cells (Vector Biolabs) along with a pAdeno-helper vector and a pRC-AAV9 rep-cap plasmid ...
-
No products found
because this supplier's products are not listed.
Amrita Sule, et al.,
bioRxiv - Cancer Biology 2021
Quote:
YFP-ATM was immunoprecipitated from stably transfected HEK293 cells by GFP-TRAP (Chromotek). The immunoprecipitates were suspended in kinase assay buffer containing 2 μCi of [γ-32P] ATP ...
-
No products found
because this supplier's products are not listed.
Martina Oravcová, et al.,
bioRxiv - Cell Biology 2022
Quote:
Endogenous level of DNA damage in HEK293 cells was evaluated using the CometAssay kit (Trevigen) according the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Emily A. Rex, et al.,
bioRxiv - Microbiology 2023
Quote:
... 5 μg of His-tagged H2A:H2B or His-H3:Flag-H4 (Diagenode) and 2 μg of Flag-hSpt16 were added to 250 μl of binding buffer (50 mM Tris-HCl pH 7.4 ...
-
No products found
because this supplier's products are not listed.
Luis Alfonso Yañez Guerra, Meet Zandawala,
bioRxiv - Evolutionary Biology 2023
Quote:
... HEK293-G5a (Angio-proteomie CAT no. cAP0200GFP-AEQ-Cyto) cells were cultured in 96 well-plates containing 100μl of DMEM (Thermo ...
-
Recombinant Antigen
Cat# REC31793-100,
100µg USD $451.0
Ask
Carmen Mirabelli, et al.,
bioRxiv - Microbiology 2021
Quote:
... HNoV GII.4 virus-like particles (VLPs) were purchased from The Native Antigen Company, Poly (I:C ...
-
No products found
because this supplier's products are not listed.
Nazila V. Jafari, Jennifer L. Rohn,
bioRxiv - Microbiology 2022
Quote:
HBLAK human bladder progenitor cells (CELLnTEC, Switzerland) were grown according to the CELLnTEC protocol ...
-
No products found
because this supplier's products are not listed.
Celia Alda Catalinas, et al.,
bioRxiv - Genomics 2023
Quote:
HEK293T suspension adapted cells (in-house) were cultured in growth media consisting of BalanCD HEK293 medium (Irvine Scientific, 91165) supplemented with 2% GlutaMAX (Thermo Fisher Scientific ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... His-tag antibody (Tiangen, Beijing, China) and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Sahil Shah, et al.,
bioRxiv - Neuroscience 2021
Quote:
... transfections were performed using primary human microglia cells (Celprogen) and primary microglia cells isolated from fresh brain tissue of rhesus macaques ...
-
No products found
because this supplier's products are not listed.
Lianghui Zhang, et al.,
bioRxiv - Microbiology 2022
Quote:
... cells were resuspended in PBS-BSA containing 1:150 polyclonal chicken anti-HIS-FITC (Immunology Consultants Laboratory) and 1:300 anti-myc-Alexa 647 (clone 9B11 ...
-
No products found
because this supplier's products are not listed.
Sk. Kayum Alam, et al.,
bioRxiv - Cancer Biology 2022
Quote:
Human DARPP-32 isoforms purified from NSCLC cells were incubated with kinase-activated human IKKα protein (SignalChem) for in vitro kinase assays by following previously described methods70 ...
-
No products found
because this supplier's products are not listed.
MEENAKSHI TETORYA, et al.,
bioRxiv - Plant Biology 2023
Quote:
His-tagged GMA4CG_WT and GMA4CG_V6 was obtained from Biomatik Inc ...
-
No products found
because this supplier's products are not listed.
Roshan Thapa, Peter A. Keyel,
bioRxiv - Cell Biology 2022
Quote:
... 2017) using human red blood cells (Zen-Bio, Research Triangle Park, NC, USA) (Table 1) ...
-
No products found
because this supplier's products are not listed.
Meng Zhang, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... Fluorescence intensity of Tb3+-labelled receptors was measured on an Infinite M1000 fluorescence plate reader (Tecan) with an excitation wavelength of 340 nm and emission wavelength of 620 nm ...
-
No products found
because this supplier's products are not listed.
Jan Steinkühler, et al.,
bioRxiv - Biophysics 2020
Quote:
... Human Transferrin – CF488A (Biotium) at 130 nM ...
-
No products found
because this supplier's products are not listed.
Noah R. Johnson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... recombinant human Aβ40 (rPeptide), recombinant human scrambled Aβ42 (rPeptide) ...
-
No products found
because this supplier's products are not listed.
Ali Khateb, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... Residual red blood cells were removed using RBC Lysis Buffer for Human (Alfa Aesar, cat. # J62990) according to the manufacturer’s instructions ...
-
Cell strainers (Falcon), components of the NCIS kit. Suitable for removal of tissue debris in...
Cat# LK003265,
5 ea, $50.00
Ask
Marc Emmenegger, et al.,
bioRxiv - Neuroscience 2021
Quote:
Differentiated human neural cultures (3 months old) were dissociated into single-cells suspension using Papain Dissociation System (Worthington #LK003150), passed through 70µm and 40µm cell strainers (Falcon #07-201-431 and #07-201-430) ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
CUT&RUN assay libraries for cultured cells or human kidneys were generated with the CUTANA kit (EpiCypher, 14-1048). For cultured cells ...
-
No products found
because this supplier's products are not listed.
Ling Ning Lam, et al.,
bioRxiv - Microbiology 2021
Quote:
... and inoculated at a ratio of 1:1000 into pooled human serum or pooled human urine (both purchased from Lee Biosolutions). At selected time points ...
-
No products found
because this supplier's products are not listed.
Philipp Radler, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Cells were lysed using a cell disrupter (Constant Systems; Cell TS 1.1) at a pressure of 1.36 kbar and subsequently incubated with 2.5 mM MgCl2 and 1 mg ml−1 DNase for 15 min ...
-
No products found
because this supplier's products are not listed.
Pamela O’Neill, et al.,
bioRxiv - Bioengineering 2023
Quote:
... ETE mAb LC and DTE mAb LC was quantified using Kappa and Lambda Human Immunoglobulin Free LC (FLC) ELISAs (BioVendor, UK) following the manufacturer’s protocol ...
-
No products found
because this supplier's products are not listed.
Megan N. Thomas, et al.,
bioRxiv - Microbiology 2023
Quote:
Serum samples collected from the indirect contact pigs at 11 DPC were prepared for the hemagglutination inhibition (HI) assay by receptor-destroying enzyme (RDE II; Hardy Diagnostics, Santa Maria, CA) treatment ...
-
No products found
because this supplier's products are not listed.
Myung Chung, et al.,
bioRxiv - Neuroscience 2024
Quote:
... HEK293-EGFP (GenTarget, Cat. No. #SC001), and NIH-3T3 (originally obtained from Riken Bioresource Research Center and gifted from Dr ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Saejeong Park, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... HEK293 cells were washed with PBS and lysed in NP-40 lysis buffer (Boston Bioproducts) including protease and phosphatase inhibitor (Roche) ...
-
No products found
because this supplier's products are not listed.
Yaoyuan Zhang, et al.,
bioRxiv - Immunology 2023
Quote:
... total immunoglobulins (IgA+IgG+IgM) ELISA kit (Alpha Diagnostic; cat # 5210) following manufacturer’s instruction.
-
No products found
because this supplier's products are not listed.
Mohita Tagore, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... or DMH1 (BMP receptor, Sigma #D8946, 0.5 µM) or EC330 (LIF receptor ...
-
No products found
because this supplier's products are not listed.
Nanami Sakata, et al.,
bioRxiv - Plant Biology 2022
Quote:
... L-His (Tokyo Chemical Industry), and L-Lys (Nacalai tesque ...
-
No products found
because this supplier's products are not listed.
Chia-En Wong, Kuen-Jer Tsai,
bioRxiv - Neuroscience 2019
Quote:
... HEK293 cells were transfected with GFP-TDP-43 by PolyJet™ DNA in vitro transfection reagent (Signagen Laboratories). Cells were seeded into a 6-well plate at a density of 5 × 105 cells/well and incubated overnight ...
-
No products found
because this supplier's products are not listed.
Maria Steene Eriksen, et al.,
bioRxiv - Biochemistry 2019
Quote:
Fluorescently tagged Arc and StrepII tagged Arc were coexpressed in HEK293 cells and purified using Strep-Tactin Sepharose (IBA Lifesciences). Formation of complexes between the indicated Arc constructs was analyzed by immunoblotting following SDS electrophoresis ...
-
No products found
because this supplier's products are not listed.
Yan Li, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or anti-PAC1 receptor (1:50 dilution, LifeSpan BioSciences, Inc.) at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Marisol Sampedro-Castañeda, et al.,
bioRxiv - Neuroscience 2023
Quote:
... rabbit anti Cav2.3 N-terminus 1:250 (Covalab, custom 1, HEK293 & brain), rabbit anti pS15 Cav2.3 1:500 (Covalab ...
-
No products found
because this supplier's products are not listed.
Ezarul Faradianna Lokman, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... Plasma was used for analyte analysis (Ghrelin, glucagon like peptide (GLP-1) and glucagon) using ELISA kit (Elabscience, China).
-
No products found
because this supplier's products are not listed.
Susanne K. Kahn, et al.,
bioRxiv - Immunology 2021
Quote:
... foals were required to have been healthy at birth and to have evidence of adequate passive transfer of immunoglobulins based on a commercial test kit (SNAP Foal IgG test, IDEXX, Inc.). At each farm ...
-
No products found
because this supplier's products are not listed.
Sohail Jahid, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... His-Cdc42 was instead dialyzed with 20 µM GppNHp (Jena Bioscience) in the presence of 5 U of Quick-CIP alkaline phosphatase (New England Biolabs) ...
-
No products found
because this supplier's products are not listed.
Ben S. Ou, et al.,
bioRxiv - Bioengineering 2023
Quote:
... HIS Lite Cy3 Bis NTA-Ni Complex was purchased from AAT Bioquest. Unless otherwise stated ...
-
No products found
because this supplier's products are not listed.
Yash Agarwal, et al.,
bioRxiv - Immunology 2020
Quote:
... Paraffin embedded fixed sections were stained via hematoxylin and eosin or with indicated human antibodies 24 (anti-human CD45-Biocare Medical Cat. No. CME PM016AA; anti-human CD3-Biocare Medical Cat ...
-
No products found
because this supplier's products are not listed.
Indira Wu, Hee Shin Kim, Tuval Ben-Yehezkel,
bioRxiv - Genomics 2019
Quote:
... while human liver total RNA and human blood total RNA were purchased from Zyagen. LoopSeq Transcriptome kit was obtained from Loop Genomics ...
-
No products found
because this supplier's products are not listed.
Damian Dudka, R. Brian Akins, Michael A. Lampson,
bioRxiv - Cell Biology 2023
Quote:
... Centromeres were labeled with CREST (human anti-human Anti-Centromere Antibody, 1:200, Immunovision, HCT-0100) and an Alexa Fluor 594–conjugated goat anti-human secondary antibody (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Joanne Durgan, et al.,
bioRxiv - Cell Biology 2020
Quote:
... J774.A1 cells expressing GFP-LC3A (human) were assayed with IgG coated magnetic beads (ProMag 3 Series-Amine, Bangs Laboratories). The magnetic beads were prepared according to the manufacture’s guidelines ...
-
No products found
because this supplier's products are not listed.
Matthew D. J. Dicks, et al.,
bioRxiv - Bioengineering 2022
Quote:
... Human coagulation Factor X (hFX) (Haematologic Technologies) was added to diluted vectors at a final concentration of 8 μg/mL ...
-
No products found
because this supplier's products are not listed.
Christin Naumann, et al.,
bioRxiv - Plant Biology 2021
Quote:
... All reagents except human ceruloplasmin (Athens Research) were purchased from Sigma-Aldrich ...
-
No products found
because this supplier's products are not listed.
Maciej Kliszczak, et al.,
bioRxiv - Cell Biology 2023
Quote:
... rabbit anti-human FAM111B (HPA038637, Atlas Antibodies) at 1:1000 (IB and IF) ...
-
No products found
because this supplier's products are not listed.
Siyuan Hao, et al.,
bioRxiv - Cell Biology 2022
Quote:
Human MYC_intron with Quasar 570 dye (Biosearch Technologies, ISMF-2066-5), human ACTB_intron with Quasar 570 dye (Biosearch Technologies ...