Labshake search
Citations for Evrogen :
1 - 36 of 36 citations for Killer cell immunoglobulin like receptor 2DL3 KIR2DL3 Human HEK293 His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2020Quote: Cells were maintained in anti-bleaching live cell visualization medium (DMEMgfp; Evrogen), supplemented with 10% fetal bovine serum at 37°C in 5% CO2 ...
-
bioRxiv - Cell Biology 2020Quote: ... Cells were maintained in anti-bleaching live cell visualization medium (DMEMgfp; Evrogen), supplemented with 10% fetal bovine serum at 37°C in 5% CO2 and rutin at a final concentration of 20 mg/l.
-
bioRxiv - Cell Biology 2019Quote: ... Cells were imaged in DMEM gfp-2 anti-bleaching live-cell imaging medium (Evrogen) supplemented with 10% fetal bovine serum (FBS) ...
-
bioRxiv - Molecular Biology 2023Quote: gDNA for T and CD45Δ T cells was obtained with an ExtractDNA Blood & Cells Kit (Evrogen, Russia) on the 2nd day after knockout ...
-
bioRxiv - Molecular Biology 2021Quote: ... Cells expressing either Katushka (pTurboFP635-N vector, Evrogen) or TagGFP2 (pTagGFP2-N vector ...
-
bioRxiv - Developmental Biology 2023Quote: ... the cells were lysed with ExtractRNA (Evrogen, Russia).
-
bioRxiv - Biochemistry 2024Quote: ... woodyi cells using an RNA Solo kit (Evrogen) and additionally digested with RNase-free DNase I (Thermo Scientific ...
-
bioRxiv - Microbiology 2023Quote: ... Plasmids were transformed into chemically competent XL1-Blue cells (Evrogen). Phusion DNA-Polymerase (NEB ...
-
bioRxiv - Cell Biology 2019Quote: ... or DMEMEGFP-2 anti-bleaching live cell visualization medium (Evrogen, #MCK02), both supplemented with 10% FBS and GlutaMAX-I (Gibco ...
-
bioRxiv - Neuroscience 2021Quote: ... Cells were then incubated with anti-tagRFP (1:1,000, Evrogen, AB233), anti-SMI312 (1:1,000 ...
-
bioRxiv - Cell Biology 2023Quote: ... medium was replaced with live-cell visualization medium DMEMgfp-2 (Evrogen) supplemented with 10 % FBS ...
-
bioRxiv - Cancer Biology 2023Quote: ... CT26 cells stably expressing near-infrared fluorescent protein eqFP650 (FP731, Evrogen) were injected subcutaneously into female Balb/c mice (12-14 weeks old ...
-
bioRxiv - Cancer Biology 2023Quote: RNA was extracted from cultured cells using the ExtractRNA kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2021Quote: ... the medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen) supplemented with 10% FBS and 2 mM L- glutamine ...
-
bioRxiv - Cell Biology 2021Quote: ... coli TG1 cells and purified using a Plasmid Miniprep kit (Evrogen, Russia).
-
bioRxiv - Immunology 2021Quote: ... medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen, cat. #MC102) supplemented with 10% FBS ...
-
bioRxiv - Immunology 2023Quote: ... medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen, cat. #MC102) supplemented with 10% FBS ...
-
bioRxiv - Cell Biology 2019Quote: ... Media was exchanged to DMEMGFP-2 anti-bleaching live cell visualization medium (Evrogen # MCK02) supplemented with 10% FBS and GlutaMAX (Gibco #35050061 ...
-
bioRxiv - Immunology 2021Quote: Phagemid DNA was isolated from bacterial cells using the Plasmid miniprep kit (Evrogen, Russia). VHH-coding sequences were sequenced with Lac-prom (5’-CTTTATGCTTCCGGCTCGTATG-3’ ...
-
bioRxiv - Genetics 2024Quote: ... cells were harvested and total RNA was isolated using the ExtractRNA reagent (Evrogen, Russia) according to the manufacturer’s recommendations ...
-
bioRxiv - Molecular Biology 2023Quote: About 1.5 µg of total RNA extracted from 106 cells with Extract RNA reactive (Evrogen) was subjected to the DNAse I treatment (Ambion ...
-
bioRxiv - Biochemistry 2020Quote: ... plasmid # 162785 Plasmids for cell transfections were purified by the Plasmid Midiprep kit (Evrogen, Moscow, Russia) and concentrated by ethanol precipitation in sterile conditions.
-
bioRxiv - Cell Biology 2021Quote: ... The HeLa mKate2-EB3 cell line was generated by transfecting a pmKate2-EB3 plasmid vector (Evrogen #FP316) into HeLa cells ...
-
bioRxiv - Cancer Biology 2023Quote: Isolation of total RNA from cells was performed using the Total RNA isolation protocol with ExtractRNA buffer (Evrogen, Russia) according to the manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2023Quote: ... All cell lines were repeatedly tested for the presence of mycoplasma contamination with a MycoReport Mycoplasma Detection Kit (Evrogen, Russia).
-
bioRxiv - Microbiology 2020Quote: ... The fixed cells were harvested (8000 g, 5 min, 4 °C) and resuspended in 1 mL of ExtractRNA Reagent (Evrogen, Russia) and the subsequent procedures were performed according to manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: ... 700 ng of PCR product was taken per one 100µl aliquot of E.coli XL1-Blue competent cells (Evrogen, Moscow, Russian Federation).
-
bioRxiv - Cell Biology 2020Quote: Murine mammary carcinoma cell line 4T1 stably expressing mitochondria-targeted eGFP was prepared by transfection with the pTagGFP2-mito vector (Evrogen, Moscow, Russia) using Lipofectamine 3000 (Thermo Scientific ...
-
bioRxiv - Genomics 2023Quote: ... The libraries were sequenced on an Illumina NovaSeq 6000 platform (S Prime flow cell) with 2 × 150 bp paired-end reads (Evrogen Joint Stock Company, Russia).