Labshake search
Citations for GenScript :
4151 - 4200 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2021Quote: ... All neutralization assays performed with the surrogate Virus Neutralization Test (sVNT) (cat. n° L00847, GenScript, Piscataway, NJ, USA) following manufacturer’s instructions ...
-
bioRxiv - Immunology 2021Quote: ... as the primary antibody and anti-Rabbit IgG conjugated to HRP (cat. n° A01827, GenScript, Piscataway, NJ, USA) (2/5000 ...
-
bioRxiv - Neuroscience 2021Quote: ... [Met5]enkephalin (Genscript, Piscataway, NJ), CTAP (Sigma ...
-
bioRxiv - Neuroscience 2021Quote: ... following the manufacturer’s instructions and protein samples were loaded on gradient 4-20% Tris-MOPS-SDS gels (GenScript). The resolved proteins were then transferred to PVDF membranes (BioRad) ...
-
bioRxiv - Neuroscience 2021Quote: TMEM106B C-terminal fragment (120 – 274) incorporated in pET3A was purchased from Genscript™ ...
-
β-amyloid−driven synaptic depression requires PDZ protein interaction at AMPA-receptor subunit GluA3bioRxiv - Neuroscience 2021Quote: ... The following antibodies were used: anti-GluA2/3 (1:2000; CQNFATYKEGYNVYGIESVKI, custom made at Genscript) (Chen et al. ...
-
bioRxiv - Neuroscience 2021Quote: ... these cells were cultured in the presence of the OVA257-264 peptide (GenScript RP10611 or Sigma S7951). After 12 hours ...
-
bioRxiv - Plant Biology 2021Quote: ... Primers were designed with Real-time PCR (TaqMan) Primer and Probes Design Tool from GenScript wesite (www.genscript.com/tools/real-time-pcr-taqman-primer-design-tool ...
-
bioRxiv - Microbiology 2021Quote: ... was synthesized and inserted in pQE-60 by GenScript USA ...
-
bioRxiv - Cell Biology 2021Quote: ... exponential cells growing in YPDA medium were synchronized with 15 μg/ml α-factor (GenScript Cat. No:RP01002) for 2h at 25 °C ...
-
bioRxiv - Cell Biology 2021Quote: ... The optimized sequence is obtained synthetically and cloned into the prokaryotic expression vector pET20b (GenScript, USA). The promoter T7 oligos were used ...
-
bioRxiv - Cell Biology 2021Quote: Synaptopodin A was synthesized by Genscript using the coding sequence of human synaptopodin (NCBI Reference Sequence: NP_009217.3) and was subcloned by Genscript into HINDIII and Xho1 sites of the blasticidin-selectable mammalian expression vector pcDNA6 myc-HisA (Invitrogen ...
-
bioRxiv - Cell Biology 2021Quote: Synaptopodin A was synthesized by Genscript using the coding sequence of human synaptopodin (NCBI Reference Sequence ...
-
bioRxiv - Cell Biology 2021Quote: The following peptides corresponding to the Sst2 amino acid sequence surround Serine 539 were synthesized by Genscript (Piscataway NJ), the phospho-Sst2 S539 peptide LHPHSPLSEC ...
-
bioRxiv - Cell Biology 2021Quote: ... Flag (Genscript), anti-p44/42 MAPK (Erk1/2 ...
-
bioRxiv - Cell Biology 2021Quote: ... Mouse anti-Tubulin antibody (1:10000, A01410, GenScript), rabbit anti-LaminB1 (1:5000 ...
-
bioRxiv - Physiology 2021Quote: The sequence encoding mouse like-acetylglucosaminyltransferase-1 (Large1) was synthesized (Genscript, Piscataway, NJ) and cloned into the AAV backbone under the transcriptional control of the ubiquitous CMV promoter ...
-
bioRxiv - Microbiology 2021Quote: ... a synthetic 999 bp fragment of the recodonized version of the CpMetRS (starting from amino acid number 247) along with the 3’UTR sequence of the enolase gene (cgd5_1960) was purchased (GenScript, NJ, USA). The synthetic construct was PCR amplified to introduce desired mutations and the 5’ homology region was introduced as an overhang in the forward primer ...
-
bioRxiv - Microbiology 2021Quote: ... Toxin specific primers were designed with the assistance of online primer design software (Genscript). Mucoricin gene primers include G7F1 ...
-
bioRxiv - Cell Biology 2021Quote: The synthetic peptides (Ac-DDDIAALC, Ac-EEEIAALC, DDDIAALC, EEEIAALC) were synthesized by GenScript (Piscataway, NJ). The DNPEP and ENPEP proteins were purchased from OriGene (Cat# ...
-
bioRxiv - Biochemistry 2021Quote: ... equal amounts of lysates were loaded and separated by SDS-PAGE using 4-12% SurePAGE Bis- Tris (GenScript) or 3-8% NuPAGE Tris-Acetate (ThermoFisher Scientific ...
-
bioRxiv - Neuroscience 2021Quote: ... loxP and lox2272 sites were removed and replaced with a synthesised cassette (GenScript) containing a multiple cloning site flanked by two sets of heterotypic (FRT and F3) ...
-
bioRxiv - Neuroscience 2021Quote: ... Detection of blot was carried out with a LumiSensorTM HRP Substrate Kit (GenScript Technology).
-
bioRxiv - Plant Biology 2021Quote: ... Elicitors flg22 (Genscript, RP19986, final 0.2 μM), chitin (from shrimp shells ...
-
bioRxiv - Plant Biology 2021Quote: ... and nlp24 (Genscript, synthesized peptide from Hyaloperonospora arabidopsidis NLP3 AIMYAWYFPKDSPMLLMGHRHDWE ...
-
bioRxiv - Neuroscience 2021Quote: ... and OCT were supplied from GenScript USA Inc ...
-
bioRxiv - Microbiology 2021Quote: ... 2 and 3 (TTCTTCTCTCCTGTCAACAG) were generated in eSpCas9-LentiCRISPR v2 (Genscript). Viral stocks were generated in 293T cells ...
-
bioRxiv - Bioengineering 2021Quote: RBD protein expressed with AviTag was purchased from GenScript. Site-specific biotinylation of the AviTag was performed using BirA Biotin-Protein Ligase Reaction kit (Avidity) ...
-
bioRxiv - Biochemistry 2021Quote: ... Vps26AQRFE-AAAA (substituted residues 311 - 314 to alanine) and Vps26B pm mutant (S302E, S304E, S311E, S319E, T325E, S327E, and S330E substitution) were synthetic genes by Genscript Corporation ...
-
bioRxiv - Biochemistry 2021Quote: ... The linear peptides DMT1-II550-568 (AQPELYLLNTMDADSLVSR) and palmitoylated CI-MPR2347-2375 with N-terminal di-lysine (KKSNVSYKYSKVNKEEETDENETEWLMEEIQ) were both synthesised by Genscript (USA).
-
bioRxiv - Microbiology 2021Quote: ... The resin was washed with 60 mL of buffer A supplemented with 2 mM CaCl2 and the bound protein was eluted from the column with 10 mL of buffer A supplemented with 5 mM EDTA and 0.2 mg/mL FLAG peptide (Genscript).
-
bioRxiv - Immunology 2021Quote: ... The resulting sequence was chemically synthesized by (GenScript Laboratories, USA) and cloned at the EcoRI/HindIII sites of pFastBac1 (Thermo Fisher Scientific ...
-
bioRxiv - Immunology 2021Quote: ... All Neutralization assays were performed with the surrogate virus neutralization test (sVNT) (GenScript, USA), following the manufacturer’s instructions ...
-
bioRxiv - Immunology 2021Quote: ... 100 µL of anti-rabbit IgG HRP conjugated (GenScript, USA) (1:30,000 ...
-
bioRxiv - Immunology 2021Quote: ... The wells were washed six times with PBS-T and incubated with 100 µL (1:10000) of Goat Anti Mouse IgG (Genscript, USA) or Anti Hamster IgG (Abcam ...
-
bioRxiv - Immunology 2021Quote: ... were coated with 100 µL of SARS-CoV-2 RBD (1 µg/mL) (GenScript, USA) in carbonate bicarbonate buffer (pH 9.6 ...
-
bioRxiv - Immunology 2021Quote: Purified RBD was loaded at 0.2 µg/well and electrophoretically separated by SDS-PAGE under non-reducing conditions and transferred to nitrocellulose membranes using an e-blot device (GenScript Laboratories, USA). The membranes were blocked with 5% (w/v ...
-
bioRxiv - Microbiology 2021Quote: ... spanning the entire genome of DENV-4M (GenBank accession:MN192436.1) were initially synthesized and cloned into pUC57 vector by Genscript (Piscataway, NJ). A T7 promoter and a hepatitis delta virus ribozyme (HDVr ...
-
bioRxiv - Neuroscience 2021Quote: ... and a FLAG-HA tag in-frame with the sORF protein sequence was synthesized by Genscript and cloned into an FUGW overexpression vector (Addgene #14883) ...
-
bioRxiv - Biochemistry 2021Quote: ... SMT (SUMO-like tag) fusion protein in a pET28a vector (Genscript). Quick Change mutagenesis was performed to generate the W611A mutant of hP13 ZnF5-WWE1-WWE2 ...
-
bioRxiv - Bioengineering 2021Quote: Codon-optimized genes for bivalent VHH-Fcs were synthesized and cloned into pTT5 (GenScript; Piscataway ...
-
bioRxiv - Bioengineering 2021Quote: ... 843 RUs of SARS-CoV-2 RBD/SD1 fused to human Fc (RBD/SD1-Fc) and 972 RUs of EGFR (Genscript, Piscataway ...
-
bioRxiv - Microbiology 2021Quote: ... respectively) were ordered as synthetic DNA in the pUC57 vector (GenScript). Via PCR ...
-
bioRxiv - Biochemistry 2021Quote: ... the fragments were inserted in frame after myc-tagged TRX1 in the pESC vector (Genscript). For production of DHFR and DHFR variants in E ...
-
bioRxiv - Biochemistry 2021Quote: ... the Nmar 1308 gene construct was purchased from Genscript Biotech (codon-optimized with cleavable N-terminal hexa-Histidine tag) ...
-
bioRxiv - Cancer Biology 2021Quote: ... we first synthesized a cassette coding the FKBP-derived destabilization domain (DD)33 along with an EcoRI restriction site and a single FLAG tag (Genscript). This cassette was then cloned into pHIV-NAT-T2A-hCD52 (kind gift of R ...
-
bioRxiv - Cancer Biology 2021Quote: ... protein – NP_001058.2) cloned into pcDNA3.1+/C-(K)-DYK vector (Clone ID OHu21029D) was purchased from Genscript. The cDNAs were cloned into a bacterial expression vector ...
-
bioRxiv - Cancer Biology 2021Quote: ... Cells expressing Hu08TM were stained with biotinylated protein L (GenScript, Piscataway, NJ) and secondary detection was achieved by the addition of streptavidin-coupled PE (BD Biosciences ...
-
bioRxiv - Cancer Biology 2021Quote: ... Biotinylated protein L (GenScript) and the addition of streptavidin-coupled PE (BD Biosciences ...
-
bioRxiv - Biochemistry 2021Quote: ... a GlySer-linker and the C-tag flanked by PmeI sites was amplified by PCR from a synthetic fragment provided by GenScript (USA), codon-optimized for expression in a low protease background C1 ...