Labshake search
Citations for GenScript :
3701 - 3750 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2021Quote: ... and a rabbit polyclonal antibody specific for calmodulin-binding peptide (A00635-40, GenScript), a Goat anti-Rabbit IgG (H+L ...
-
Efficient Suppression of Endogenous CFTR Nonsense Mutations Using Anticodon Engineered Transfer RNAsbioRxiv - Molecular Biology 2021Quote: ... SmaI multiple cloning site in pUC57 was synthesized (Genscript). The hyperPB transposase sequence (58 ...
-
bioRxiv - Molecular Biology 2021Quote: ... The operon was synthetized and cloned using SacI and SpeI restriction sites by GenScript yielding plasmid pSEVA338_MTs ...
-
bioRxiv - Biochemistry 2021Quote: RBD inhibition assay: HEK-293T cells stably expressing hACE2 (GenScript M00770) were seeded into a 24-well plate at an initial density of 6 x 104 cells per well ...
-
bioRxiv - Biochemistry 2021Quote: ... HEK-293T stable transfected with ACE2 (GenScript M00770, 8000 cells per assay), Caco2 cells (40,000 cells per assay) ...
-
bioRxiv - Biochemistry 2021Quote: ... codon optimized for human cell expression (GeneArt/ Scientific) was first cloned in an expression vector comprising the pXLG gene expression cassette in a pUC57 vector backbone (GenScript) between BamHI and SalI restriction sites as described (39) ...
-
bioRxiv - Bioengineering 2021Quote: ... The mixtures were subsequently separated by 4–20% SDS-PAGE Gel (GenScript) and transferred to poly-vinylidene fluoride (PVDF ...
-
bioRxiv - Biochemistry 2021Quote: The codon-optimized sequences for the three subunits of avian influenza A/Goose/Guangdong/1/1996 (H5N1) virus polymerases were synthesized (GenScript) and cloned into pFastBac expression plasmid for polymerase expression and structure determination ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... Lanes were excised using a razor and incubated in 1x Tris-MOPS running buffer (Genscript, Piscataway, New Jersey) with 100 mM DTT and 5 mM sodium bisulfite at 55°C for 10 min ...
-
bioRxiv - Genetics 2021Quote: ... Flag-SARS-CoV-B.1.351-S were all obtained from GenScript (Cloned into pcDNA 3.1 vector). Flag-SARS-CoV-2-S1493-685 was made in GenScript.
-
bioRxiv - Immunology 2021Quote: ... all from GenScript, EUA ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... Luciferase reporter plasmids were synthesized (GenScript) by cloning the response elements from the pGL4.29[luc2P/CRE/Hygro] ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... rolani was custom synthesized by GenScript (Leiden, Netherlands). The sequence was H-SGGMSLCLWKVCPAAPWLVS-OH ...
-
bioRxiv - Biophysics 2021Quote: The genes were codon-optimized for mammalian expression (IDT codon optimization tool) and synthesized by GenScript. The genes were subsequently cloned into pcDNA 3.1 (pcDx ...
-
bioRxiv - Cancer Biology 2021Quote: ... that contains a N-terminal His TEV cleavage tag by Genscript. Protein expression was carried out in Escherichia coli C41(DE3) ...
-
bioRxiv - Cancer Biology 2021Quote: ... cells were stained with biotinylated protein L (GenScript, Piscataway, NJ), goat anti-mouse IgG ...
-
bioRxiv - Cancer Biology 2021Quote: ... The guide RNAs were cloned into the enhanced specificity CRISPR/Cas9 plasmid (eSpCas9-LentiCRISPR, v2, Genscript) (26) ...
-
bioRxiv - Cell Biology 2021Quote: ... Cas9 protein was purchased from Genscript (Cat. No. Z03389). Cas9 protein (12 µg ...
-
bioRxiv - Cell Biology 2021Quote: ... Designed gRNAs were purchased from Genscript’s synthetic gRNA and crRNA service (gRNA T256 ...
-
bioRxiv - Immunology 2021Quote: The pcDNA3-mouseENPP1-FLAG plasmid was synthesized by Genscript. The Xac NPP-MBP-pMAL plasmid was a gift from Dr ...
-
bioRxiv - Immunology 2021Quote: ... The HA gene was condon optimized for swine species (GenScript). The HA gene was cloned under the vaccinia virus (VACV ...
-
bioRxiv - Immunology 2021Quote: ... Flag-tag specific mouse antibody (Genscript, catalog no: A100187) and HA-tag specific rabbit antibody (Cell Signaling ...
-
bioRxiv - Immunology 2021Quote: ... An E gene DNA standard (pUC57-2019-nCoV-PC:E, GenScript, Piscataway, NJ) was also run at the same time for conversion of Ct value to genomic copies ...
-
bioRxiv - Immunology 2021Quote: ... Peptides from ORF1ab-C were sourced from Genscript technologies ...
-
bioRxiv - Immunology 2021Quote: ... peptide pools (GenScript) at a concentration of 2 μg/mL per peptide ...
-
bioRxiv - Immunology 2021Quote: ... synthesized in vitro and subcloned into a pcDNA3.4 vector containing the human IgG1 or IgA1 Fc region by a commercial partner (Genscript). Transfection grade plasmids were purified by maxiprep and transfected into a 293-6E expression system ...
-
bioRxiv - Immunology 2021Quote: ... as well as anti- GAPDH– HRP conjugate (A00192; GenScript), incubations were carried out for 1 h at room temperature ...
-
bioRxiv - Immunology 2021Quote: ... Antigens included recombinant SARS-CoV−2 RBD protein obtained from the Saphire laboratory at LJI or recombinant nucleocapsid protein (GenScript Z03488). The next day ...
-
bioRxiv - Immunology 2021Quote: ... cells were stimulated ex vivo with 5 μg/mL OVA257-264 peptide (GenScript) for 4 hours in the presence of Golgi stop (BD Biosciences ...
-
bioRxiv - Immunology 2021Quote: Membrane proteins from OP-treated or untreated JEG-3 or purified FC-tagged full length or truncated domains of CRT were incubated with 20 μg of NCR-Myc fusion proteins at 4° C with rotary agitation for 16 h and then with 100 μl anti-Myc coupled magnetic beads (Genscript) at 4° C with rotary agitation for 4 h ...
-
bioRxiv - Immunology 2021Quote: ... Enriched B cells were stained with Flag tagged SARS-CoV-2 spike (Genscript, Z03481) then incubated with APC conjugated anti-Flag and PE conjugated anti-Flag for double staining ...
-
bioRxiv - Immunology 2021Quote: ... nonreducing gels and transferred using eBlot L1 Transfer system (GenScript). Blots were blocked in 5% Bovine Serum Albumin (BSA ...
-
bioRxiv - Immunology 2021Quote: ... a 3.5kb fragment of the human CLEC7A promoter region (chr12:10129421-10132905) was synthesized (GenScript) and cloned into the secreted Nano-Glo luciferase vector pNL1.3 (Promega) ...
-
bioRxiv - Immunology 2021Quote: ... To monitor V2 responses cyclized C.1086 V2 (cV2, synthesized by GenScript) 157CSFNATTELKDKKHKVHALFYKLDVVPLNGNSSSSGEYRLINC196 was used at 1μg/ml in PBS for coating ...
-
bioRxiv - Immunology 2021Quote: The cDNA of membrane glyco-protein (MGP) and Non-structure protein 13 (NSP13) of ORF1b from SARS-CoV-2 were purchased from Genscript (NJ, USA) and cloned into lentiviral vector pLVX (TAKARA ...
-
bioRxiv - Immunology 2021Quote: Biotinylated SARS-CoV-2 S1 protein and biotinylated SARS-CoV-2 N protein were purchased from GenScript. The biotinylated proteins were combined with different streptavidin (SA ...
-
bioRxiv - Immunology 2021Quote: ... Mutation of the STAT3 binding site (wt: TTTCCAAGCAC, mut: TGGAAGGGCAC) in CENSER was performed commercially (GenScript). CENSER and proximal deletion constructs were done using the QuikChange mutagenesis kit (Agilent) ...
-
bioRxiv - Microbiology 2021Quote: ... were synthesized and cloned into pcDNA3.1+ (GenScript). All DNA constructs were verified by Sanger sequencing (ACGT).
-
bioRxiv - Microbiology 2021Quote: ... These spike sequences were synthesized and cloned into pcDNA3.1+(GenScript). Human and hamster ACE2 (Q9BYF1.2 and GQ262794.1 ...
-
bioRxiv - Cell Biology 2021Quote: ... with synthetic RpHLuorin2 (Genscript) with restriction sites SbfI and BsrGI ...
-
bioRxiv - Cell Biology 2021Quote: The sequence of RpHLuorin235 was synthesized by Genscript for both recombinant (codon optimized for E ...
-
bioRxiv - Cell Biology 2021Quote: ... Targeting to the MGAT2-positive compartment was achieved by inserting synthetic truncated MGAT2 (residues 1-89 of Uniprot Q10469, Genscript) in the vector for cytosolic expression of RpHLuorin2 with restriction sites EcoRI and BamHI ...
-
bioRxiv - Microbiology 2021Quote: ... and B.1.526 Spikes were codon-optimized and synthesized by Genscript. Plasmids encoding B.1.617 ...
-
bioRxiv - Genomics 2021Quote: ... The expression plasmid was synthesized from GenScript. Two 6x His-tags were co-expressed at both the N-terminus and the C-terminus of the recombinant protein using T7 Express Competent E ...
-
bioRxiv - Bioengineering 2021Quote: ... All peptides used in this study were purchased from GenScript USA ...
-
bioRxiv - Synthetic Biology 2021Quote: ... or ScaI restriction sites were synthesized by GenScript® (Piscataway ...
-
bioRxiv - Microbiology 2021Quote: The cDNAs encoding ACE2 orthologs (Table S1) were synthesized by GenScript and cloned into pLVX-IRES-zsGreen1 vectors (Catalog No ...
-
bioRxiv - Microbiology 2021Quote: ... coli (GenScript, NJ, USA) and subcloned into expression vector pBAD/myc-His A (Invitrogen ...
-
bioRxiv - Biochemistry 2021Quote: ... Primary antibodies (anti-FLAG M2; Sigma and chimeric ACE2-Fc (Genscript; Z03484) were diluted in PBS-BSA to 1 μg mL−1 and added to each imaging dish ...
-
bioRxiv - Cell Biology 2021Quote: The CHIKV and zebrafish Cavin4b proline-rich peptides were synthesized by GenScript® and dissolved in sterile water to a concentration of 6 mM stock solution ...