Labshake search
Citations for GenScript :
5451 - 5500 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2020Quote: ... cerevisiae and obtained from GenScript. Sam50 ...
-
bioRxiv - Microbiology 2020Quote: ... feoB1 was synthesized and cloned into XmaI and XbaI sites of the vector pMTL-84151 by Genscript. Primers used in the study are in Table S3 ...
-
bioRxiv - Microbiology 2020Quote: ... The sgRNA (Table S5) targeting the abovementioned genes were synthesized and cloned into the vector’s PmeI site by Genscript Biotech (New Jersey) ...
-
bioRxiv - Microbiology 2020Quote: ... coli situated in pET28b were purchased from Genscript (Piscataway, NJ). Sequence data for these constructs are provided as supplemental data ...
-
bioRxiv - Microbiology 2020Quote: ... The DNA fragment was then inserted into the KpnI and HindIII digested pLJ-Ssc70-Myc backbone using the CloneEZ™ PCR Cloning Kit (GenScript) to get pLJ-Hsp70-Myc plasmid ...
-
bioRxiv - Microbiology 2020Quote: ... regions of the TSPs Sh-TSP2 and MS3_01370 (predicted using TMPRED) were codon optimized based on yeast codon usage preference and synthesized by GenScript (NJ, US). The synthesized coding DNAs with a 6-His-tag expressed at the C-terminus were cloned into the pPinkα-HC expression vector (Thermofisher ...
-
bioRxiv - Microbiology 2020Quote: ... albicans (GenScript, Piscataway, NJ). Next ...
-
bioRxiv - Microbiology 2020Quote: ... GrgA and mutants were detected using a monoclonal anti-His antibody (Genscript, Cat. A00186) and a mouse anti-GrgA antibody (35).
-
bioRxiv - Microbiology 2020Quote: ... the proteins were transferred to nitrocellulose membrane (Genscript) by the Genscript eBLOT L1 fast wet protein transfer system ...
-
Chemical Stabilization of the HIV-1 Capsid Results in Efficient HIV-1 Reverse Transcription in vitrobioRxiv - Microbiology 2020Quote: ... 15 μl volumes of the gradient fractions were separated by electrophoresis on precast 4-20% polyacrylamide gels (Genscript). The proteins were transferred to nitrocellulose membrane ...
-
bioRxiv - Microbiology 2020Quote: ... Supernatants were recovered and 20 μg protein were separated on SurePAGE Bis-Tris 4-12% gradient gel following the manufacturer’s instructions (Genscript). A protein standards ladder (BioRad #1610374 ...
-
bioRxiv - Microbiology 2020Quote: ... cloned and produced by Genscript. The antigenic unit with either RBD or Spike was synthesized and cloned into a pUMVC4a VB10 master plasmid using SfiI-SfiI restriction enzyme sites ...
-
bioRxiv - Biochemistry 2020Quote: ... Blots were developed using HRP conjugated Goat anti-mouse IgG (Genscript) and luminata crescendo (Millipore) ...
-
bioRxiv - Molecular Biology 2020Quote: pNB30 (dat-1p::gfp) and pNB50 (dat-1p::SNCAWt) vectors expression were produced by a gene synthesis manufacturer (GenScript). For amplification ...
-
bioRxiv - Developmental Biology 2020Quote: ... Antigen for the custom anti-Nrl antibody (commissioned from Genscript, Piscataway, NJ, USA) was recombinant protein matching the C-terminal 112 amino acids of zebrafish Nrl (residues 301-412 of GenBank ...
-
bioRxiv - Biochemistry 2020Quote: ... followed by a TEV cleavage site and a hexahistidine-tag was cloned between NdeI and BamHI restriction sites of a pET-11a vector by Genscript with a codon optimization ...
-
bioRxiv - Molecular Biology 2020Quote: ... or vector control plasmids (Genscript, Piscataway, NJ) were diluted in Opti-MEM media (ThermoFisher ...
-
bioRxiv - Synthetic Biology 2020Quote: ... YAS1 and TADH1 separately from Genscript 001 using primer pair pYDA27/28 and pYDA29/30 ...
-
bioRxiv - Synthetic Biology 2020Quote: ... pSensor09 was constructed by amplifying the backbone plasmid p416TEF1 using primer pair pYDA05/20 and primer pair pYDA21/22 to amplify PTEF1-YAS3-TCYC1 (Genscript_003).
-
bioRxiv - Synthetic Biology 2020Quote: ... cassette YAS2-TPDC6 (Genscript_002) amplified using primer pair pYDA16/17 and PPGK1 overlapping with YAS2-TPDC6 using primer pair pYDA18/19 ...
-
bioRxiv - Synthetic Biology 2020Quote: ... p413CYC1 and pALK1-GFP were digested with PstI and assembled with cassette PPGK1-YAS1-TADH1 (Genscript_001) amplified using primers pYDA14/15 ...
-
bioRxiv - Cell Biology 2020Quote: ... and a scrambled control peptide (GenScript) were used for addback experiments ...
-
bioRxiv - Synthetic Biology 2020Quote: ... driven by pSurvivin and encoding both GLuc2 and CD:UPRT separated by the P2A self-cleavage peptide sequence (pSurvivin-GLuc2-P2A-CD:UPRT-PP) was designed in-house and built by Genscript (NJ, USA). Single-transgene pSurvivin-driven PPs were designed and made in-house using In-Fusion HD Cloning Kits (Takara Bio ...
-
bioRxiv - Molecular Biology 2020Quote: Exogenous immunoprecipitation was performed by anti-Flag IP resin (L00425, GenScript) or anti-Myc magnetic beads (B26201 ...
-
bioRxiv - Microbiology 2020Quote: Codon-optimized cDNAs (Genscript) encoding EEHV1A gB (accession number AAN03667 ...
-
bioRxiv - Microbiology 2020Quote: ... and Py2087ACR1 were synthesized (GenScript, Piscataway, NJ) and cloned in frame with mCherry into the pmCherry-C1 vector using NheI and AgeI restriction sites (FastDigest ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... SLIGRL-NH2 (> 95% purity by HPLC/MS) was purchased from Genscript (Piscataway, NJ) or EZBiolabs (Carmel ...
-
bioRxiv - Systems Biology 2020Quote: ... resolved on a 4-20% gradient ExpressPlus™ PAGE gels (GenScript) and transferred to PVDF membranes (Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2020Quote: ... while a plasmid standard from a synthetic construct of the P74 gene of SGHV from GenScript was used as a positive control ...
-
bioRxiv - Biochemistry 2020Quote: ... DNA polynucleotides encoding the transmembrane domains showing homology to previously known ACRs optimized for human codon usage were synthesized (GenScript, Piscataway, NJ) and cloned into the mammalian expression vector pcDNA3.1 (Life Technologies ...
-
bioRxiv - Molecular Biology 2020Quote: ... elegans were codon-optimized using SnapGene codon-optimization tool and synthesized by GenScript. Transgenic worms expressing NIR-GECO2(G ...
-
bioRxiv - Plant Biology 2020Quote: ... tRNA-guide4-tRNA and tRNA-guide4-tRNA-guide10-tRNA-guide18 sequences were synthesized by GenScript and were inserted at the HpaI and SmaI site by directional cloning.
-
bioRxiv - Zoology 2020Quote: ... Gels were stained with Coomassie brilliant blue using eStainTM L1 (Genscript).
-
bioRxiv - Zoology 2020Quote: ... 10 wells (Genscript, Nanjing, China). Gels were stained with Coomassie brilliant blue using eStainTM L1 (Genscript).
-
Adaptation of the Romanomermis culicivorax CCA-adding enzyme to miniaturized armless tRNA substratesbioRxiv - Molecular Biology 2020Quote: ... coli and synthesized in pET28a by GenScript® (Piscataway ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... and pcDNA3.1(+)-GgSall4-DYKDDDDK and pcDNA3.1(+)-GgPlzf-DYKDDDDK were purchased from GenScript. HsCRBN was amplified and the BP reaction sequence (attB and attP ...
-
bioRxiv - Biochemistry 2020Quote: ... or into pcDNA3.1-(+)-N-DYK (nsp2) to append an N-terminal FLAG tag (GenScript).
-
bioRxiv - Neuroscience 2020Quote: ... St3-Halo was generated by replacing the GFP in St3-eGFP with Halo tag (GenScript USA Inc, NJ). The following reagents were used ...
-
bioRxiv - Biochemistry 2020Quote: ... The solubility test was performed by GenScript, Inc (Table S1).
-
bioRxiv - Biochemistry 2020Quote: The selected LDKA-like peptides were synthesized using standard Fmoc chemistry and purified to 98% purity using reverse phase HPLC by GenScript, Inc (Piscataway ...
-
bioRxiv - Synthetic Biology 2020Quote: ... bicistronic constructs were cloned (GenScript®) in pET28b+ (kanamycin resistant) ...
-
bioRxiv - Developmental Biology 2020Quote: ... synthesized and purified by GenScript (Piscataway, NJ). The antigen sequence (MCFKCQQTGHFARECPNESAAGENGDRPKPVTYVPPTPTEDEEEMFRSTIQQGINFEKYDQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPHHHHHH ...
-
bioRxiv - Immunology 2020Quote: ... The samples were analyzed under non-reducing conditions on a 12 % SDS-PAGE gel (GenScript) using the SilverQuest silver staining kit (Invitrogen) ...
-
bioRxiv - Bioengineering 2020Quote: ... a fragment containing arrays of four tandem variable gRNAs targeting GFP with an extra DR and a seven-thymine terminator followed by the OpIE2-GFP marker was synthesized and subcloned into the above digested OA-1043 backbone using Gene Synthesis (GenScript USA Inc., Piscataway, NJ). We have also made all plasmids and sequence maps available for download and/or order at Addgene (www.addgene.com ...
-
bioRxiv - Bioengineering 2020Quote: ... corresponding to different target genes followed by an extra DR and a seven-thymine terminator was synthesized and subcloned into the digested backbone using Gene Synthesis (GenScript USA Inc., Piscataway, NJ). To generate construct OA-1050J ...
-
bioRxiv - Synthetic Biology 2020Quote: ... The blots were then washed twice in TBST and incubated with horseradish peroxidase (HRP)-conjugated secondary antibody (GenScript) for 2 hours in TBST ...
-
bioRxiv - Biochemistry 2020Quote: ... goat anti-rabbit/HRP (Genscript) and rabbit anti-mouse/HRP (DAKO)-conjugated secondary were incubated with the blots to detect GBA2 (rabbit polyclonal antibodies ...
-
bioRxiv - Immunology 2020Quote: ... zooepidemicus lacking the N-terminal signal seqence was synthesized and cloned into pGEX-6P-3 expression vector using BamHI and SalI restriction sites (Genscript). E ...
-
bioRxiv - Immunology 2020Quote: Peptides and peptide libraries were generated by custom peptide synthesis (Genscript), re-suspended at 10 mg ml−1 in DMSO and placed at −80°C for prolonged storage ...
-
bioRxiv - Immunology 2020Quote: A DMS library of the target MAGE-A3168-176 EVDPIGHLY peptide was designed and generated by custom peptide synthesis (Genscript). Each library member (n = 171 ...