Labshake search
Citations for Takara Bio :
51 - 100 of 780 citations for Family With Sequence Similarity 46 Member B FAM46B Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Developmental Biology 2022Quote: ... the IRES sequence from pLVX-IRES-Puro (Clontech; 632186), and sfGFP (superfolder GFP ...
-
bioRxiv - Bioengineering 2021Quote: ... the coding sequences were amplified from pEGFP-C1 (Clontech) with PCR and cloned into the pCDH-CMV-MCS-EF1-Puro vector (Promega) ...
-
bioRxiv - Genetics 2022Quote: ... the mCherry sequence amplified by PCR from pmCherry (Clontech) was inserted into pBS-UASp (pBS-UASp-mCherry) ...
-
bioRxiv - Developmental Biology 2020Quote: ... T2ATdTomato sequence was generated by PCR of pTdTomato (Clontech). The integrity of the vector was tested by sub-cloning the entire expression cassette into CAG IRES Puro vector and the Tdtomato signal confirmed in transient transfected ESCs by flow cytometry.
-
bioRxiv - Cell Biology 2023Quote: ... Clone and sequence using the pMD18-T vector (TaKara).
-
bioRxiv - Genetics 2022Quote: ... The capsid sequence of pRC5 (Takara Bio, Shiga, Japan) was replaced by AAV.GT5 and AAV-Spark100 for production of each AAV serotype.
-
bioRxiv - Synthetic Biology 2023Quote: ... T cells were incubated at 3×104 cells/well in 96-well U bottom plates for 24 hours in T cell media containing 50 IU/mL rhIL-2 and varying concentrations of AP20187 (B/B homodimerizer, Takara, 635058). After 24 hours ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Molecular Biology 2021Quote: ... cultivated in mTESR1 and grown 48hrs before functionality of the suicide gene was assessed by adding the chemical inducer of dimerization (CID) (AP20187, B/B Homodimerizer, Clontech Laboratories, Inc), or AP1903 ...
-
A New Gene Set Identifies Senescent Cells and Predicts Senescence-Associated Pathways Across TissuesbioRxiv - Cell Biology 2021Quote: ... 86% of 2% Tween 20 in deionized Water) or AP20187 (B/B homodimerizer, Clontech; 10 mg of AP20187 per kg body mass) twice weekly at the age of 20 months for a total of 4 months (old mice were sacrificed at 24 months of age) ...
-
bioRxiv - Molecular Biology 2023Quote: ... The recombinant AAV2 genome rAAVeCFPrep was constructed by replacing the mCherry coding sequence in the plasmid pAAVtCR (18) with the ECFP coding sequence from pECFP (Clontech, Mountain View, CA, USA). Purified recombinant AAV2 vectors ...
-
bioRxiv - Cancer Biology 2023Quote: ... 12 µg RetroNectin solution (TaKaRa Biomedicals, cat# T100A/B) in PBS was added to each well of untreated 6-well plates (Greiner ...
-
bioRxiv - Molecular Biology 2019Quote: ... The GRK2 sequence was cloned into pN1-sYFP2 vector (Clontech) using NheI and AgeI sites ...
-
bioRxiv - Cancer Biology 2021Quote: The eGFP coding sequence from the pEGFP-C2 vector (Clontech), with or without the coding sequence of wild-type human TRPV2 (12 ...
-
bioRxiv - Molecular Biology 2020Quote: ... The DNA sequence for E2-Crimson was sourced from Clontech. The gene for the fluorescent-HSD11B1 was ligated into vector pcDNA3.1 (Invitrogen ...
-
bioRxiv - Cancer Biology 2022Quote: ... Sequences derived from pRetroX-G1-Red and pRetroX-SG2M (Clontech) were cloned into pHR lentiviral vectors under puromycin or blasticidin selection ...
-
bioRxiv - Cell Biology 2023Quote: ... the EGFP sequence was PCR amplified from pEGFP-N1 (Clontech), and cloned in the pAIB-CAG lentiviral vector (a gift from Claudio Ballabio ...
-
bioRxiv - Molecular Biology 2019Quote: ... the ß-arrestin sequences were cloned into pC1 or pN1 (Clontech) to generate ...
-
bioRxiv - Biochemistry 2019Quote: ... the LRAT sequence was cloned into a pEGFP-N2 vector (Clontech), resulting in LRAT fused to the N-terminus of GFP ...
-
bioRxiv - Cell Biology 2021Quote: ... The EGFP coding sequence was amplified from pEGFP-N1 vector (Clontech) with the following primers ...
-
bioRxiv - Biochemistry 2022Quote: ... the coding sequences were cloned into pColdI vector (Takara Bio Inc.).
-
bioRxiv - Developmental Biology 2019Quote: ... a 3.8kb tert sequence was PCR amplified using ExTaq polymerase (Takara) and ligated in pDXA-GFP2 vector by exploiting the HindIII and KpnI restriction sites ...
-
bioRxiv - Plant Biology 2019Quote: Gene sequences were amplified by PCR using ExTaq DNA Polymerase (TaKaRa) for cloning purposes (primers are listed in supplementary table 1) ...
-
bioRxiv - Cell Biology 2020Quote: ... The EGFP sequence was amplified by PCR using pEGFP-N1 (Clontech) as a template ...
-
bioRxiv - Cell Biology 2023Quote: ... the respective sequence was amplified by PCR from pEGFP C1 (Clontech, Takara Bio Europe ...
-
bioRxiv - Cancer Biology 2024Quote: ... The sgRNA sequences were amplified using Taq polymerase (Takara Bio, Inc.) and adapted for sequencing ...
-
bioRxiv - Developmental Biology 2021Quote: The MmAtxn10 coding sequence was cloned into the pEGFP-N1 vector (Clontech) using primers designed with XhoI and AgeI restriction sites ...
-
bioRxiv - Molecular Biology 2019Quote: ... Sequences were determined by commercial Sanger sequencing service (Takara Bio, Kusatsu, Japan). The sequences which were successfully determined (total 448 bp ...
-
bioRxiv - Developmental Biology 2021Quote: ... and amplified sequences were inserted using InFusion (InFusion HD Cloning kit, Clontech). Plasmid constructs were injected into one-cell zygotes and integrated into the genome via Ac-mediated recombination ...
-
bioRxiv - Cell Biology 2020Quote: ... was subcloned by replacing the EGFP sequence of pEGFP-N1 (Clontech, Takara) [24] ...
-
bioRxiv - Cell Biology 2020Quote: ... was subcloned by replacing the EGFP sequence of pEGFP-N1 (Clontech, Takara) [24] ...
-
bioRxiv - Cell Biology 2022Quote: ... and GFP-KDEL sequence were expressed from C1/N1 vector series (Clontech) and have been previously described (Jongsma et al. ...
-
bioRxiv - Biochemistry 2022Quote: ... Zebrafish PAC coding sequence (NP_001278691) was subcloned into pIRES2-EGFP vector (Clontech) using NheI and EcoRI restriction enzyme sites ...
-
bioRxiv - Molecular Biology 2019Quote: The mGFP coding sequence was amplified using CloneAmp HiFi PCR Premix (Clontech) and a forward primer containing the T7 promoter sequence (Merck ...
-
bioRxiv - Genomics 2019Quote: ... Wild-type sequences were generated by PCR using human genomic DNA (Clontech) as a template ...
-
Measuring adaptation dynamics to hydrogen peroxide in single human cells using fluorescent reportersbioRxiv - Cell Biology 2020Quote: ... The Grx1-roGFP2 sequence was cloned into a pEGFP-N1 backbone (Clontech) with CMV promotor to avoid lentiviral transfection strategy ...
-
bioRxiv - Cell Biology 2020Quote: ... The sequence was ligated into the pLVX Puro lentiviral plasmid (Clontech, CA) using the same restriction sites and sequenced to confirm correct orientation ...
-
bioRxiv - Immunology 2022Quote: ... TCR coding sequences were cloned into lentiviral backbones using InFusion HD (Takara), with oligonucleotides synthesized by IDT ...
-
bioRxiv - Developmental Biology 2023Quote: ... PCR-amplified donor sequences were independently cloned by In-fusion reaction (Takara) into the backbone of the Addgene plasmid 58409 which contains the homology arms (HA ...
-
bioRxiv - Cell Biology 2023Quote: ... the respective sequence was amplified by PCR from pEGFP C1 (Clontech, Takara Bio Europe ...
-
bioRxiv - Synthetic Biology 2023Quote: ... pTRE3G and rtTA3G sequences were amplified from pTRE3G-BI-ZsGreen1 (Takara #631339) and pCMV-Tet3G Vector (Takara # 631335) ...
-
bioRxiv - Cell Biology 2023Quote: ... cDNA sequence of Bqt3 was amplified and cloned into pGBKT7-DB (Clontech) at EcoRI and BamHI sites for the yeast two-hybrid assay ...
-
bioRxiv - Neuroscience 2021Quote: ... cells were treated with 100ug/mL hygromycin B (Takara bio 631309). Cells were exposed to 100ug/mL hygromycin B for 8 days ...
-
bioRxiv - Immunology 2020Quote: ... plates were coated with 40 μg/mL retronectin (TAKARA, # T100A/B) overnight at 4°C ...
-
bioRxiv - Developmental Biology 2021Quote: ... and the ATOH1 enhancer sequence was cloned using in-fusion HD cloning (Clontech). Subsequently ...
-
bioRxiv - Plant Biology 2022Quote: ... The HMWG::TaVIT2-D sequence was inserted by In-Fusion cloning (Takara Bio) in the HindIII restriction site upstream of ZmUBI1::OsNAS2 ...
-
bioRxiv - Molecular Biology 2020Quote: ... Sequence was then inserted in the plasmid pEGFP-C1 (Clontech, Mountain View, CA) at Sma1 site ...
-
bioRxiv - Molecular Biology 2019Quote: ... The AT1AR sequence was cloned into pN1-mCherry and pN1-p2A-mCherry (Clontech) using HindIII and AgeI sites ...
-
bioRxiv - Cell Biology 2019Quote: ... The eGFP and COMMD1 coding sequence was subcloned to pTre-TIGHT-Bi (Clontech) by introducing a BamH1 site upstream of the eGFP start codon and ligating the eGFP-COMMD1 insert into the BamH1 and SalI sites of pTRE-Tight-BI (Clontech) ...
-
bioRxiv - Cell Biology 2020Quote: ... WDR90 coding sequence was then cloned into a modified pEGFP-C1 vector (Clontech) containing Asc I and Pac I restriction sites.