Labshake search
Citations for Evrogen :
251 - 300 of 381 citations since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2021Quote: ... Blots were incubated overnight at 4°C with primary antibodies targeting Tag(CGY)FP (1:2000 dilution in 1% milk, Evrogen, Cat#: AB121), HaloTag (1:1000 dilution in 0.5% milk ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Cancer Biology 2021Quote: ... The RFP tag is a monomeric TagRFP from Evrogen.
-
bioRxiv - Molecular Biology 2021Quote: ... The reverse transcription reaction was performed using reagents for RT with an OT-Random primer (Agrodiagnostika) and a kit of reagents MMLVRTkit (Evrogen, Russia), according to the manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2021Quote: ... a set of PCR reagents Master-mix ScreenMix HS (Evrogen, Russia), 5xMasCFGTaqMIX-2025 (unstained ...
-
bioRxiv - Molecular Biology 2021Quote: The following primers and a probe were used for real-time PCR (synthesis at Evrogen, Russia):
-
bioRxiv - Plant Biology 2021Quote: ... The cDNA for qRT-PCR was synthesized using an MMLV RT Kit (Evrogen, Russia) according to the manufacturer’s recommendations employing oligo(dT)17 -primers from 2 μg total RNA after DNase treatment ...
-
bioRxiv - Immunology 2021Quote: Phagemid DNA was isolated from bacterial cells using the Plasmid miniprep kit (Evrogen, Russia). VHH-coding sequences were sequenced with Lac-prom (5’-CTTTATGCTTCCGGCTCGTATG-3’ ...
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Cell Biology 2021Quote: ... pDendra2-C vector (Evrogen) was modified ...
-
bioRxiv - Microbiology 2021Quote: ... pTAG-BFP-N (Evrogen, FP172) was used.
-
bioRxiv - Immunology 2021Quote: ... medium was replaced by live-cell visualization medium DMEMgfp-2 (Evrogen, cat. #MC102) supplemented with 10% FBS ...
-
bioRxiv - Microbiology 2021Quote: Gene encoding TurboFP650 was amplified from the plasmid pTurboFP650-N (Evrogen, Euromedex, France) with primers TurboFP650-XbaI 5’TGCTCTTAGATTTAAGAAGGAGATATAGATATGGGAGAGGATAGCGAGCTG3’ and TurboFP650-SphI 5’CATGCATGCTTAGCTGTGCCCCAGTTTGCTAGG3’ ...
-
bioRxiv - Neuroscience 2021Quote: ... TagRFP (Evrogen) or emiRFP670 (ref66) ...
-
bioRxiv - Neuroscience 2021Quote: Additional reporter constructs (Extended data Fig. 7j) were cloned by exchanging EGFP from LV-EF1a-H2B-EGFP with TagBFP (Evrogen), TagRFP (Evrogen ...
-
bioRxiv - Microbiology 2021Quote: ... The pG8-GFP plasmid was derived from pG8 by cloning the TagGFP2 gene (Evrogen) following the Gibson assembly protocol (NEB) ...
-
bioRxiv - Microbiology 2021Quote: ... 2 μl 10x Taq Turbo buffer (Evrogen), 0.25 mM dNTPs ...
-
bioRxiv - Plant Biology 2021Quote: ... tagRFP fusion proteins were detected using the anti-tRFP (rabbit polyclonal, Evrogen AB233) diluted 1:5000 (v/v) ...
-
bioRxiv - Immunology 2021Quote: Tersus Plus PCR Kit (Evrogen) was used for all amplification procedures ...
-
bioRxiv - Immunology 2021Quote: ... ScreenMix Kit (Evrogen) was used according to the manufacturer’s protocol ...
-
bioRxiv - Immunology 2021Quote: ... The resulting NemR-cpYFP-bearing vectors were purified with the use of Plasmid Miniprep Kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Immunology 2021Quote: ... The restricted polynucleotides were purified with Cleanup Standard Kit (Evrogen) and ligated with T4 DNA ligase in the corresponding buffer (Evrogen ...
-
bioRxiv - Immunology 2021Quote: ... and ligated with T4 DNA ligase in the corresponding buffer (Evrogen) at 14°C overnight ...
-
bioRxiv - Immunology 2021Quote: ... the corresponding gene was amplified with the use of the №17/№34 primer pair and purified with Cleanup Standard Kit (Evrogen). The obtained construct and intact PCS2+ vector were incubated with ClaI and XbaI FastDigest™ enzymes in the corresponding buffer (Thermo Scientific ...
-
bioRxiv - Immunology 2021Quote: ... the target product was separated from the nontarget byproducts with horizontal DNA electrophoresis in agarose gel and purified with Cleanup Standard Kit (Evrogen). To engineer pQE30-NemR-cpYFP plasmids ...
-
bioRxiv - Immunology 2021Quote: ... The lack of any undesired mutations in the engineered genes was established by DNA sequencing (Evrogen).
-
bioRxiv - Evolutionary Biology 2021Quote: ... or obtained by purification of salt method extracted DNA (Aljanabi & Martinez, 1997) using CleanUp Standard kit (Evrogen, Moscow). The dsDNA quantity was measured using dsDNA HS Assay Kit for fluorometer Qubit 3 (Life Technologies ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2021Quote: ... The HeLa mKate2-EB3 cell line was generated by transfecting a pmKate2-EB3 plasmid vector (Evrogen #FP316) into HeLa cells ...
-
bioRxiv - Cell Biology 2021Quote: ... The fragment was purified using a Cleanup Standard kit (Evrogen, Russia), digested with EcoRI and KpnI enzymes (SibEnzyme ...
-
bioRxiv - Cell Biology 2021Quote: ... coli TG1 cells and purified using a Plasmid Miniprep kit (Evrogen, Russia).
-
bioRxiv - Cell Biology 2021Quote: ... a DNA fragment containing the hepatitis A virus 3C protease (3Cpro) gene with EcoRI and KpnI sites was generated by PCR using the primers GACTGAATTCGCCACCATGTCAACTCTAGAAATAGCAGG and CAACGGTACCTTACTGACTTTCAATTTTCTTATCAATG (Evrogen, Russia), and pBI-EGFP-3C [11] as the template ...
-
bioRxiv - Immunology 2021Quote: The RBD nucleotide sequence of SARS-CoV-2 Wuhan-Hu-1 isolate (Genbank accession number MN908947, from 319 to 545 aa) was synthesized (Evrogen, Russia) and cloned into the pCEP4 mammalian expression vector (Thermo Fisher Scientific ...
-
Kinetics Of Interferon-λ And Receptor Expression In Response To In Vitro Respiratory Viral InfectionbioRxiv - Immunology 2021Quote: ... were commercially synthesized and HPLC- purified (Evrogen, Russia).
-
bioRxiv - Biochemistry 2021Quote: The AstaP construct was verified by DNA sequencing (Evrogen, Moscow, Russia) and used to transform chemically competent cells ...
-
bioRxiv - Synthetic Biology 2021Quote: ... The first round consisted of 15 cycles (Encyclo polymerase, Evrogen) and used N-shifted primers to increase complexity ...
-
bioRxiv - Neuroscience 2021Quote: ... Rabbit anti-tRFP 1:500 (Evrogen AB233), Rabbit anti-S100 1:300 (VWR/ProteinTech 15146-1-AP) ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... with the addition of an enzymatic repeats depletion step using a Duplex-Specific Nuclease (DSN; Evrogen, Moscow, Russia) (Matvienko et al. ...
-
bioRxiv - Developmental Biology 2021Quote: ... Amplification was performed using EncycloPlus PCR kit (Evrogen, Moscow, Russia) using the following program ...
-
bioRxiv - Cell Biology 2021Quote: ... Mito-PhiYFP (pPhi-Yellow-mito) was from Evrogen (#FP607). GW1-pHRed and GW1-Mito-pHRed were gifts from Gary Yellen (Addgene #31473 and #31474 ...
-
bioRxiv - Molecular Biology 2021Quote: Total RNA was extracted with ExtractRNA reagent (Evrogen) from 2 mL of exponentially growing E ...
-
bioRxiv - Immunology 2021Quote: ... The original vector pCasper-GR (#FP971) was from Evrogen. BSA ...
-
bioRxiv - Molecular Biology 2021Quote: ... Cells expressing either Katushka (pTurboFP635-N vector, Evrogen) or TagGFP2 (pTagGFP2-N vector ...
-
bioRxiv - Molecular Biology 2021Quote: ... PCRs were done with Encyclo DNA polymerase (Evrogen, Moscow) and the AR9 genomic DNA as a template ...
-
bioRxiv - Immunology 2021Quote: The sequence encoding for Casper3-GR was amplified from pCasper3-GR (Evrogen # FP971) with the following primers introducing an XhoI recognition site at both ends of the amplicon ...
-
bioRxiv - Cell Biology 2021Quote: ... Split Dendra2 was generated by separating mDendra2 (Evrogen, Moscow, Russia) at Proline 191 to generate Dendra1-10 ...
-
bioRxiv - Developmental Biology 2021Quote: An embryonic cDNA expression library was prepared from total RNA with a Mint cDNA synthesis kit (Evrogen, Russia) using the SMART approach ...
-
bioRxiv - Developmental Biology 2021Quote: ... Amplified fragments were cloned into the pAL-TA vector (Evrogen, Russia). Digoxygenine- labeled antisense RNA probes were generated from gene fragments ...
-
bioRxiv - Cell Biology 2021Quote: ... for reverse transcription (MMLV RT kit) and for real time PCR (HS SYBR kit) were obtained from Evrogen, Russia ...
-
bioRxiv - Neuroscience 2021Quote: ... Cells were then incubated with anti-tagRFP (1:1,000, Evrogen, AB233), anti-SMI312 (1:1,000 ...