Labshake search
Citations for Thermo Fisher :
3601 - 3650 of 5196 citations for Tryptase gamma Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... 1.5 µg of peptide was analysed on the Exploris 480 coupled with a Dionex Ultimate 3000 RS (Thermo Scientific). LC buffers prepared as follows ...
-
bioRxiv - Biochemistry 2023Quote: ... Eluted peptides were analysed by using an Orbitrap Fusion Lumos Tribrid Mass Spectrometer (Thermo Fisher Scientific, Waltham, MA, USA).
-
bioRxiv - Biophysics 2023Quote: The PUR4 (also known as FUD) peptide (sequence: KDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNMVETEDT) and the scrambled control (sequence: EKGYSKPPVGNEGGDQVDEYDTMSQTKLEDEGNTLISPITFENATEQVN) were synthesised by ThermoFisher Scientific without any tags or modifications ...
-
bioRxiv - Cell Biology 2023Quote: ... All native peptides not captured by the phosphopeptide enrichment kits were then separated by offline medium pH C4 peptide fractionation (Accucore 150-C4, 2.6um pore size, 150mm X 2.1mm, Thermo Scientific) using gradient mobile phase conditions as previously reported (76) ...
-
bioRxiv - Physiology 2024Quote: ... Approximately 7 µg of tryptic peptide from each tissue sample was labeled with TMT-Pro 16 plex (Thermo Scientific) reagents according to the manufacturer’s instructions ...
-
bioRxiv - Plant Biology 2024Quote: ... Eluting peptides were on-line ionized by nano-electrospray (nESI) using the Nanospray Flex Ion Source (Thermo Fisher Scientific) at 1.5 kV (liquid junction ...
-
bioRxiv - Bioengineering 2024Quote: ... Peptides were then analysed on a Ultimate 3500 RSLCnano system (Dionex) and a Q-Exactive HF (Thermo Fisher Scientific) mass spectrometer ...
-
bioRxiv - Systems Biology 2024Quote: DISPA of the plasma proteome peptides was performed on an Orbitrap Fusion Lumos™ mass spectrometer (Thermo Fisher Scientific) coupled with the FAIMS Pro Interface ...
-
bioRxiv - Plant Biology 2024Quote: ... peptide/ protein identification and MS1-based label-free quantification (LFQ) were performed using Proteome Discoverer 2.5 (PD2.5) (Thermo Scientific). For IP-MS analysis ...
-
bioRxiv - Physiology 2024Quote: ... Peptides were loaded in buffer A (0.1 % formic acid) onto a 110 cm mPAC HPLC column (Thermo Fisher Scientific) and separated with a non-linear gradient of 1 – 50 % buffer B (0.1 % formic acid ...
-
Spatiotemporal proteomics reveals the biosynthetic lysosomal membrane protein interactome in neuronsbioRxiv - Cell Biology 2024Quote: ... Peptides were loaded onto a trap column (C18 PepMap100, 5 μm, 100 Å, 5 mm × 300 μm, Thermo Fisher Scientific ...
-
bioRxiv - Physiology 2024Quote: ... the peptides were concentrated on an Accalaim μ-Precolumn (0.5 mm × 3 mm, particle size 5 μm; Thermo Scientific) in the isocratic mode at a 10 μL/min flow for 5 min in the mobile phase C (2% acetonitrile ...
-
bioRxiv - Immunology 2024Quote: ... Peptides were loaded onto an Acclaim PepMap100 nanoViper C18 trap column (100 µm inner diameter, 2 cm; Thermo Scientific) in HPLC buffer C with a constant flow of 10 µl/min ...
-
bioRxiv - Neuroscience 2024Quote: Fractionated peptides were analysed by LC-MS/MS using a fully automated Ultimate 3000 RSLC nano System (Thermo Scientific). Peptides were trapped with a PepMap100 C18 5 μm 0.3X5 mm nano trap column (Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2024Quote: ... peptides were resolved using an EASY-Spray capillary HPLC column (ES902A, 75 µm × 25 µm, 100Å, 2μm, Thermo Scientific) and a Vanquish Neo UHPLC (Thermo Fisher Scientific ...
-
bioRxiv - Systems Biology 2024Quote: ... Peptides were separated on a 75 µm × 50 cm EASY-Spray C18 column (2 µm, 100 Å; Thermo Scientific) at 50 °C using a linear gradient from 10% to 40% B in 153 min with a flow rate of 200 nL/min ...
-
bioRxiv - Immunology 2024Quote: ... injections into both hind flanks of 0.5 μmol/mL MOG35-55 peptide emulsified in incomplete Freuds adjuvant (Cat# 77145; ThermoFisher) supplemented with 4 mg/mL heat-killed M ...
-
bioRxiv - Cancer Biology 2024Quote: ... reconstituted peptides were analysed on a Dionex Ultimate 3000 system coupled with the nano-ESI Fusion Lumos (Thermo Scientific). Peptides were loaded on the Acclaim PepMap 100 ...
-
bioRxiv - Plant Biology 2024Quote: ... Approximatively 200ng of each peptide sample were concentrated onto a C18 pepmap 100 (5mm x 300µm i.d.) precolumn (Thermo Scientific) and separated at 50°C onto a reversed phase Reprosil column (25cm x 75μm i.d. ...
-
bioRxiv - Cancer Biology 2024Quote: ... Each peptide extracts were loaded on a 300 µm ID x 5 mm PepMap C18 precolumn (Thermo Scientific, USA) at a flow rate of 20 µL/min ...
-
bioRxiv - Developmental Biology 2024Quote: ... peptides in 1% (vol/vol) formic acid were injected onto an Acclaim PepMap C18 nano-trap column (Thermo Scientific). After washing with 0.5% (vol/vol ...
-
bioRxiv - Biochemistry 2024Quote: ... approximately 100 nanograms of peptide were analyzed by LC-MS/MS with an EASY-nLC 1200 (Thermo Fisher Scientific) and an Orbitrap Eclipse Tribrid mass spectrometer (Thermo Fisher Scientific ...
-
bioRxiv - Genomics 2024Quote: ... tryptic peptide mixtures were analyzed by nano-scale high-performance liquid chromatography (Proxeon EASY-Nano system, Thermo Fisher Scientific) coupled with online nanoelectrospray ionization tandem MS (Q-Exactive HF-X mass spectrometer ...
-
bioRxiv - Microbiology 2024Quote: ... peptides were subjected to electrospray ionization and loaded into either an Orbitrap Exploris 480 mass spectrometer (Thermo Fisher Scientific) or a Velos Orbitrap Pro ion-trap mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Microbiology 2024Quote: ... peptides were analyzed on a Q-Exactive HFX Hybrid Quadrupole-Orbitrap Mass Spectrometer (Thermo Fisher Scientific, Rockford, IL, USA) coupled with a high-performance liquid chromatography system (EASY nLC 1200 ...
-
bioRxiv - Microbiology 2024Quote: ... peptides were resuspended in 10.5 µL of 0.1% FA containing 40 fmol of DionexTM Cytochrome C digest (Life Technologies) (CytoC ...
-
bioRxiv - Physiology 2024Quote: ... Peptides were loaded in buffer A (0.1 % formic acid) onto a 110 cm mPAC HPLC column (Thermo Fisher Scientific) and separated with a non-linear gradient of 1 – 50 % buffer B (0.1 % formic acid ...
-
bioRxiv - Immunology 2024Quote: ... in presence of 0.1 μM [4Y]-MBP peptide in a final volume of 200 μl RPMI1640 + L-glutamine (GIBCO) containing 10% FCS and 1% penicillin/streptomycin (Life Technologies) ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... and then incubated in the dark for 1 h with secondary antibodies in 200 μl of blocking buffer (polyclonal goat anti-mouse Alexa Fluor® 488, 1:200 (A32723, ThermoFisher) and goat anti-rabbit Alexa Fluor® 647 ...
-
bioRxiv - Immunology 2021Quote: ... Plates were blocked with blocking buffer made with 2% bovine serum albumin (BSA) Fraction V (Thermo Fisher Scientific, Waltham, MA, USA) and 1% gelatin from bovine skin (Sigma-Aldrich ...
-
bioRxiv - Cell Biology 2020Quote: ... Coverslips were again washed twice in blocking buffer for 10min and mounted on slides with ProLong Diamond Antifade (Thermo Fisher #P36965) for imaging ...
-
bioRxiv - Cell Biology 2020Quote: ... and treated with donkey Alexa Fluor 488-conjugated anti-rabbit IgG secondary antibody (A21206, Life Technologies; 1:1000 in blocking buffer) overnight at 4°C ...
-
bioRxiv - Neuroscience 2020Quote: ... They then had further blocking solution added to them containing Alexa Fluor 488/568 secondary antibodies (1:1000; Thermo Fisher Scientific) in addition to DAPI (1:2000 ...
-
bioRxiv - Neuroscience 2022Quote: ... slices were washed in TBS-T and incubated for 1 h at RT with a mixture of the following secondary antibodies diluted 1:200 in blocking solution: anti-guinea pig Alexa Fluor 488 (Life Technologies) and anti-rabbit Alexa Fluor 568 (Life Technologies ...
-
bioRxiv - Biophysics 2022Quote: ... in blocking buffer followed by 10 min incubation at room temperature with goat anti-rabbit IgG/horseradish peroxidase-conjugate (1:10,000 dilution of 1 mg/mL stock in blocking buffer) (A16110, Thermo Fisher Scientific). The blot was developed using enhanced chemiluminescence detection reagents (Pierce™ ECL Western Blotting Substrate ...
-
bioRxiv - Bioengineering 2022Quote: ... The following secondary antibodies were used at 1:1000 dilution in blocking solution: Alexa Fluor 647 anti-Rabbit (Thermo Fisher, #A21244), Alexa Fluor 647 anti-Goat (Thermo Fisher ...
-
bioRxiv - Immunology 2022Quote: ... A secondary antibody mixture was made using the same permeabilization/blocking solution with 1:1000 dilution of anti-mouse Alexa Flour 488 (Thermo Fisher) overnight at 4 °C ...
-
bioRxiv - Developmental Biology 2022Quote: ... then incubated in blocking buffer composed of 1×PBS supplemented with 10% Gibco Fetal Bovine Serum (Thermo Fisher Scientific, Cat. A4766801) and 0.1% Triton X-100 ...
-
bioRxiv - Neuroscience 2019Quote: To perform immunocytochemistry cells were fixated with 4% Paraformaldehyde and blocked with blocking buffer containing 5% Normal Goat Serum (Gibco®), 0,1% bovine serum albumin (SigmaAldrich ...
-
bioRxiv - Neuroscience 2019Quote: ... Sections were subsequently incubated for 1 hour at room temperature in blocking buffer containing the Alexa Fluor goat anti-mouse 488 or Alexa Fluor goat anti-rabbit 546 (Life Technologies) secondary antibodies (each at 1:1000 dilution ...
-
bioRxiv - Cell Biology 2019Quote: ... After a final wash in blocking solution the coverslips were mounted on glass slides by inverting them onto mounting solution (ProLong Gold antifade, Molecular Probes). For the characterization of the HEK293 Flag-BirA*-LUZP1 line ...
-
bioRxiv - Biophysics 2020Quote: ... cells were incubated in blocking buffer with 4 ng/µl of multiple-labeled goat anti-rabbit IgG secondary antibodies (Invitrogen, 31212) with different DOLs for the α-tubulin ...
-
bioRxiv - Neuroscience 2020Quote: ... Slices were then incubated overnight (4°C) in the same blocking solution containing the primary rabbit anti-PV antibody (1:1000; Thermo Scientific) and mouse anti-SST antibody (1:250 ...
-
bioRxiv - Plant Biology 2020Quote: ... Slides were washed three times for 5 min in 1X PBS solution and then incubated for 3 h at room temperature in 100 μL blocking buffer containing Alexa 488-conjugated goat anti-rabbit secondary antibody (Molecular Probes, Invitrogen), diluted 1:200 in fresh blocking buffer ...
-
bioRxiv - Microbiology 2021Quote: ... Primary antibodies were diluted in 0.5% BSA in PBS blocking solution: 1:400 ZO-1 (Cat#40-2200, Thermo Fisher Scientific); 1:1000 MUC5AC (Cat#MA5-12178 ...
-
bioRxiv - Neuroscience 2020Quote: ... Membranes were washed in TBS-T buffer and then incubated for an hour at room temperature with the corresponding horseradish peroxidase-conjugated preadsorbed secondary antibody (1/2000, blocking solution corresponding, Molecular Probes). Membranes were washed in TBS-T buffer ...
-
bioRxiv - Neuroscience 2020Quote: ... Sections were then rinsed again in buffer solution and then immersed in secondary antibody solution (blocking solution and 1:500 donkey anti-mouse IgG conjugated with Alexa Fluor 488 (Thermo Fisher Scientific Cat# A-21202 ...
-
bioRxiv - Neuroscience 2020Quote: ... was added together with labelled α-bungarotoxin (to visualise post-synaptic acetylcholine receptors) in blocking solution for 1.5 h at room temperature (RT) (α-btx, Life Technologies). Then ...
-
bioRxiv - Neuroscience 2021Quote: ... Membranes were then placed in blocking solution with secondary antibody [Alexa Fluor 790 Goat anti-Rabbit and/or Alexa Fluor 680 Goat anti-Mouse (Thermo Fisher)] at a dilution of 1:1000 ...
-
bioRxiv - Neuroscience 2021Quote: ... Membranes were washed in TBS-T buffer and then incubated for an hour at room temperature with the corresponding horseradish peroxidase-conjugated pre-adsorbed secondary antibody (1:5000, blocking solution corresponding, Molecular Probes). Membranes were washed in TBS-T buffer and immunoreactive bands were visualized with the SuperSignal West Pico Chemiluminescent Substrate (Pierce) ...