Labshake search
Citations for Thermo Fisher :
301 - 350 of 10000+ citations for Anti Flag Affinity Gel since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... Soluble fractions containing HA-FoxP3 and Flag-Runx1 (400 μl each) were mixed together and incubated with anti-HA magnetic beads (4 μl) (Thermo Scientific) for 1 hour at 4°C with slow rotation ...
-
bioRxiv - Cell Biology 2021Quote: ... followed by an anti-mouse secondary antibody (V5: 1 hr, RT, 1/500; Invitrogen, Cat #A21200; FLAG: 2 hr, RT, 1:200; Invitrogen, #A11004) according to the manufacturer instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... syp-mCh and SSF-tagged opioid receptors using the lipofectamine method were incubated for 15 minutes with Alexa-647 conjugated anti-FLAG antibody (1/1000, M1 antibody from Sigma, Alexa Fluor 647 Protein Labeling Kit from Thermo Fisher) before neurons were washed 3 times with HBS and mounted on the microscope in HBS ...
-
bioRxiv - Cell Biology 2023Quote: ... to detect HA-tagged TRPM2 channel domain and the lower part of the membrane was incubated with rabbit-anti-FLAG (DYKDDDDK) antibody (1:1000; 701629; Invitrogen, USA) to detect FLAG-tagged NUDT9H domain and NUDT5 ...
-
bioRxiv - Microbiology 2023Quote: ... The membrane was blocked with PBS + 0.1% Tween 20 (PBS-T) and 5% nonfat milk prior to incubating in monoclonal anti-FLAG M2 antibody (1:40,000, Sigma, Thermo Scientific™). overnight at 4 °C followed by Goat-anti Mouse IgG-HRP secondary antibody (Invitrogen™ ...
-
bioRxiv - Cell Biology 2023Quote: ... the transfected cells were blocked with 5% BSA at room temperature for 15 min and labeled with anti-FLAG antibody (1:100, Thermo Fisher) at 4°C for 1 h ...
-
bioRxiv - Microbiology 2020Quote: ... PCR amplicon was purified with E-Gel EX gel (Invitrogen) and QIAquick PCR Purification Kit (Qiagen) ...
-
bioRxiv - Bioengineering 2020Quote: ... and 2% agarose gels (E-Gel, #G501802, Thermo Fisher Scientific).
-
bioRxiv - Microbiology 2020Quote: ... gel extracted using the GeneJET Gel Extraction kit (Thermo Scientific) and cloned into the p2CT plasmid (gift by James Berger ...
-
bioRxiv - Systems Biology 2021Quote: ... Lysates were analyzed with SDS – polyacrylamide gel electrophoresis gels (Invitrogen). Proteins were transferred onto polyvinylidene difluoride (PVDF ...
-
bioRxiv - Cell Biology 2022Quote: ... Gels were stained with SyproRuby protein gel stain (Life Technologies) according to the manufacturer’s instructions and imaged on a Typhoon FLA 9500 biomolecular imager (GE Healthcare) ...
-
bioRxiv - Biochemistry 2022Quote: ... The gel was stained with Gel-code Blue (Thermo Fisher) and the WNG1 bands were cut out into small pieces and transferred to fresh tubes ...
-
bioRxiv - Biophysics 2023Quote: ... and gel purified using an Invitrogen gel purification kit (Invitrogen) following the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2023Quote: ... native 6% acrylamide gels (Novex™ TBE-Urea Gels, Invitrogen) were used ...
-
bioRxiv - Cell Biology 2023Quote: ... 10% Tris-Glycine gel (Invitrogen Novex 10% Tris-Glycine gel) was pre-run at 200V for 70 min in the cold room until current dropped to 10 mA/Gel ...
-
bioRxiv - Biophysics 2019Quote: ... Protease was purified by affinity chromatography using Ni2+-NTA beads (Thermo Fisher Scientific) and dialysis into storage buffer (50 mM HEPES ...
-
bioRxiv - Biochemistry 2020Quote: ... Protein was purified first through affinity chromatography with HisPur Cobalt resin (Thermo Scientific), with a lysis buffer containing 50 mM Tris-HCl pH 8 ...
-
bioRxiv - Biochemistry 2020Quote: ... The clarified lysates were applied to cobalt affinity resin (HisPur, Thermo Fisher Scientific) and washed with additional lysis buffer prior to elution with lysis buffer containing 250 mM imidazole ...
-
bioRxiv - Microbiology 2020Quote: ... The supernatants were applied onto affinity columns with HisPurTM Cobalt Resins (Thermo Scientific) and purification was carried out according to manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2020Quote: ... Elution from the affinity medium was achieved using 1.1x LDS (ThermoFisher Scientific #NP0008). Protein extraction solutions used and obtained SDS-PAGE ...
-
bioRxiv - Developmental Biology 2022Quote: ... The dialyzed 293T CM was passed through a Cobalt-affinity column (ThermoFisher Scientific) once to eliminate non-specific bound proteins ...
-
bioRxiv - Biochemistry 2021Quote: ... The protein was purified through affinity chromatography with HisPur Cobalt resin (Thermo Scientific), washing with an increased concentration of salt (1 M NaCl) ...
-
bioRxiv - Biochemistry 2021Quote: ... Protein was purified first through affinity chromatography with HisPur Cobalt resin (Thermo Scientific), eluted in 100 mM imidazole ...
-
bioRxiv - Microbiology 2021Quote: ... MBP-PfGet4 and MBP-PfGet2CD were affinity purified using amylose-resin (Thermo Fisher) and eluted with elution buffer (50 mM Tris ...
-
bioRxiv - Biochemistry 2022Quote: ... before loading onto a pre-equlibrated POROS CaptureSelect AAVX affinity column (Thermo Fisher) at 1E+13 vg per mL of resin ...
-
bioRxiv - Cell Biology 2022Quote: ... it was purified by affinity chromatography using SulfoLink Coupling Resin (Thermo Fisher Scientific) coupled with a synthetic peptide of the sequence CQMPLLDSNTSHQIMDTNPDEEFSPNS (GenScript) ...
-
bioRxiv - Plant Biology 2022Quote: ... The supernatant was then purified using Ni-NTA His affinity agarose (Thermo Scientific) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2024Quote: ... Affinity purifications were carried out using MyOne Streptavidin C1 beads (Thermo Fisher Scientific) at 4°C for 4 hours ...
-
bioRxiv - Cell Biology 2024Quote: ... Affinity resin was prepared at room temperature: 100 μl Protein G Dynabeads (Invitrogen) were washed 3x in B-ChIP-BL (0.5 mg/ml BSA in PBS) ...
-
bioRxiv - Neuroscience 2023Quote: ... Supernatant was incubated with CaptureSelect™ IgG-CH1 Affinity Matrix (Thermo Fisher 1943200250) and antibodies were eluted by acidic elution with (pH 2.8 ...
-
bioRxiv - Immunology 2024Quote: ... Proteins were purified via CaptureSelect™ C-tag affinity matrix (Thermo Fisher Scientific). A further SEC polishing step was performed on a HiLoad 16/60 Superdex 200 pg column (GE Healthcare ...
-
bioRxiv - Immunology 2023Quote: ... Resulting proteins were purified via CaptureSelect LC-lambda (mouse) affinity matrix (ThermoFisher, 194323010) or Ni-NTA agarose (Qiagen ...
-
bioRxiv - Neuroscience 2024Quote: ... a synthetic Ca2+ indicator dye with high Ca2+ affinity (KD=170 nM; Invitrogen) and comparatively fast kinetics (57) ...
-
bioRxiv - Molecular Biology 2024Quote: ... before loading onto a pre-equilibrated POROS CaptureSelect AAVX affinity column (Thermo Fisher) at 1 × 1013 vg per mL of resin ...
-
bioRxiv - Bioengineering 2024Quote: ... Monomeric ConM gp120 was captured with C-Tag affinity column (Thermo Scientific, 2943072005), ConM gp120 F10 and SOSIP were captured with house-made PGT145 or CH01 columns ...
-
bioRxiv - Cancer Biology 2021Quote: ... encoding the inhibitory biologic (FLAG-mCherry2-GGSGGS-SIWWPD) and the control biologic (FLAG-mCherry2-GGSGGS-SIWWHR) were cloned into pEF6 vector (Thermo Fisher Scientific) by standard restriction enzyme digestion and T4 DNA ligation ...
-
CASC3 promotes transcriptome-wide activation of nonsense-mediated decay by the exon junction complexbioRxiv - Molecular Biology 2020Quote: 293 WT and 293 CASC3 KO clone H cells expressing either FLAG or FLAG-EIF4A3 were labeled by maintaining them for 5 passages in DMEM for SILAC medium (Thermo Fisher Scientific) supplemented with FBS (Silantes) ...
-
bioRxiv - Molecular Biology 2021Quote: ... 2.5 μg FLAG-hRpn13-expressing plasmid or 5 μg FLAG-hRpn131-279-expressing plasmid by using lipofectamine 3000 (Thermo Fisher Scientific, L3000015) according to the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2021Quote: The plasmid DNA expressing the CAHS1-FLAG (pCAGGS-CAHS1-FLAG) protein was transfected into HeLa Italy cells with 293fectin transfection reagent (Thermo Fisher Scientific). The cells were seeded on 4-well glass-base dishes (Greiner ...
-
bioRxiv - Biochemistry 2021Quote: ... of a test GPCR with N-terminal HA-derived signal sequence and FLAG-epitope tag followed by a flexible linker (MKTIIALSYIFCLVFADYKDDDDKGGSGGGGSGGSSSGGG; ssHA-FLAG-GPCR) in 200 μl of Opti-MEM (Thermo Fisher Scientific). To measure dissociation of the other G-protein families ...
-
Satb2 acts as a gatekeeper for major developmental transitions during early vertebrate embryogenesisbioRxiv - Developmental Biology 2020Quote: ... the cells were transfected with either empty FLAG vector or FLAG-SATB2 constructs for overexpression using Lipofectamine 2000 (Invitrogen, Carlsbad, California, USA) as per manufacturer’s guidelines.
-
bioRxiv - Systems Biology 2022Quote: The bacterial transformation of the plasmids for exogenous expression of FLAG-KRAS (pMDS-TetOn3G-kozak-FLAG-KRAS WT/mutants) was performed using the One-Shot™ Stbl3TM (Invitrogen, C737303) chemically competent bacterial cells to replicate each plasmid following the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2023Quote: Insect cell derived recombinant His6-mEGFP-FLAG and MBP-eIF2A-His6-FLAG was expressed in ExpiSf9 cells using the ExpiSf Expression System Starter Kit (Thermo Fisher # A38841) following the manufacturer’s protocol ...
-
bioRxiv - Cancer Biology 2023Quote: U2OS cells were transiently transfected with FLAG-NLS-WT or FLAG-NLS-R62D-Actin for 24 hours with Lipofectamine 3000 (Thermo Fisher Scientific) according to the manufacturer’s instructions and grown on sterile 12-mm diameter glass coverslip coated with poly-L-lysine ...
-
bioRxiv - Neuroscience 2022Quote: ... 1.5mm gel (Thermofisher) and separated at 130V for ca ...
-
bioRxiv - Cell Biology 2023Quote: ... MiniProtein Gels (Invitrogen) with Tris-Glycine-SDS running buffer (BioRad) ...
-
bioRxiv - Cancer Biology 2024Quote: ... Protein gel (Invitrogen). Antibodies were added according to the manufacturers recommended conditions ...
-
bioRxiv - Developmental Biology 2024Quote: ... Undigested and digested products were resolved in a 3% Metaphor 1:1 (Lonza)/agarose gel (Invitrogen) gel ...
-
bioRxiv - Cell Biology 2021Quote: ... FLAG-MHC202 was subcloned into pcDNA5/FRT/TO (Invitrogen). Myc-tagged HCMV strain AD169 US11 (UniProt ID P09727 ...
-
bioRxiv - Cancer Biology 2019Quote: ... then performed Flag IP using Dynabeads (Thermo Fisher Scientific) coupled to anti-Flag M2 (Millipore Sigma ...