Labshake search
Citations for Thermo Fisher :
3001 - 3050 of 9391 citations for Mumps Virus Nucleoprotein Strain L Zagreb since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2024Quote: ... 2 mM L-glutamine (Gibco catalog #25030081), 10 mM HEPES (Gibco catalog #15630130) ...
-
bioRxiv - Microbiology 2024Quote: ... peptone 5 g/L (Thermo Fisher Scientific). P ...
-
bioRxiv - Bioengineering 2024Quote: ... containing 6mM L-Glutamine (Gibco™, 12569079) in Erlenmeyer flasks (T125ml ...
-
bioRxiv - Microbiology 2024Quote: ... supplemented with 2 mM L-glutamine (Gibco), 100 IU/ml penicillin-streptomycin (Gibco ...
-
bioRxiv - Biochemistry 2024Quote: ... 2 mM L-glutamine (Gibco, 25030-024), 1 mM sodium pyruvate (Gibco ...
-
bioRxiv - Cancer Biology 2024Quote: ... and 1% L-Glutamine (25030-024, Gibco) in a 24-well plate (3524 ...
-
bioRxiv - Microbiology 2024Quote: ... 2 mM L-glutamine (GlutaMAX supplement; ThermoFisher), 20 U/mL IL-2 (AIDS Reagent Program ...
-
bioRxiv - Neuroscience 2024Quote: ... 1% L-glutamine (Life technologies 25030-081), 1% penicillin-streptomycin (Life technologies 15070-063) ...
-
bioRxiv - Neuroscience 2024Quote: ... 1% L-glutamine (Life Technologies, 25030-081), 4 mg/mL DNAase (Roche ...
-
bioRxiv - Neuroscience 2024Quote: ... 1% L-glutamine (Life technologies 25030-081), 1% penicillin-streptomycin (Life technologies 15070-063) ...
-
bioRxiv - Immunology 2024Quote: ... supplemented with L-glutamine (#25030024 Gibco Thermofisher), and 10% fetal bovine serum (FBS ...
-
bioRxiv - Molecular Biology 2024Quote: ... 1× penicillin/streptomycin/l-glutamine (Gibco, 10378), 50 μM β-mercaptoethanol (Gibco ...
-
bioRxiv - Neuroscience 2024Quote: ... L-glutamine (2mM, Cat# 25030-081; Gibco), triiodothyronine (T3 ...
-
bioRxiv - Molecular Biology 2024Quote: ... 2 mM L-glutamine (ThermoFisher, #25030–024), 100 μM 2-mercaptoethanol (Sigma-Aldrich ...
-
bioRxiv - Molecular Biology 2024Quote: ... 2 mM L-glutamine (Gibco #25030–024), sodium pyruvate (Sigma #S8636-100ML) ...
-
bioRxiv - Neuroscience 2024Quote: ... L-glutamine (2mM, Cat# 25030-081; Gibco), triiodothyronine (T3 ...
-
bioRxiv - Molecular Biology 2024Quote: ... 2 mM L-glutamine (Gibco #25030–024), 2 mM sodium pyruvate (Sigma #S8636-100ML) ...
-
bioRxiv - Molecular Biology 2024Quote: ... and L-glutamine (2 mM, Gibco #25030081). To knockout the ADPRS gene ...
-
bioRxiv - Molecular Biology 2024Quote: ... 2 mM L-glutamine (Life Technologies #25030024) and 100 units/ml penicillin-streptomycin solution (Life Technologies ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM L-glutamine (Gibco, 25030–024), and 1% penicillin/streptomycin (BioConcept ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM L-glutamine (Gibco, 25030–024), and 1% penicillin/streptomycin (BioConcept ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM L-glutamine (Gibco, 25030–024), and 1% penicillin/streptomycin (BioConcept ...
-
bioRxiv - Developmental Biology 2024Quote: ... 2.2 mM L-Glutamine (Thermo Fisher – 25030081), 0.5x B27 (Invitrogen – 17504044) ...
-
bioRxiv - Genomics 2024Quote: ... + 1% L-Glutamine (Gibco catalogue number 25030081)) ...
-
bioRxiv - Neuroscience 2024Quote: ... 3g/L D-glucose (Thermo Fisher, A2494001), 1% N2 supplement-B (Stemcell Technologies ...
-
bioRxiv - Molecular Biology 2024Quote: ... and 0.29 mg/mL L-glutamine (Gibco). The HeLa-JVM strain originally was obtained from the laboratory of Dr ...
-
bioRxiv - Immunology 2024Quote: ... supplemented with L-glutamine (#25030024 Gibco Thermofisher), and 10% fetal bovine serum (FBS ...
-
bioRxiv - Developmental Biology 2021Quote: Escherichia coli (E. coli) strain DH5α (Toyobo, Osaka, Japan) and BL21(de3) pLysS (C606003, ThermoFisher Scientific) were used for DNA cloning and protein expression ...
-
bioRxiv - Molecular Biology 2021Quote: ... Genomic DNA of the test strains was digested by NotI restriction enzyme (Gibco-BRL, Gaithersburg, MD) and Salmonella enterica serovar Braenderup was digested using XbaI ...
-
bioRxiv - Developmental Biology 2020Quote: RNA was collected from indicated strains as well as from RNAi treatments using TRIZOL Reagent (Invitrogen). Three biological replicates ...
-
bioRxiv - Molecular Biology 2021Quote: RNA from indicated strains was extracted from mixed stage populations of animals using TRIzol reagent (Invitrogen), then alcohol precipitated ...
-
bioRxiv - Biochemistry 2020Quote: ... Saccharomyces cerevisiae strain InvSc1 (MATa adc2-1 his3-11,15 leu2-3,112 trp1-1 ura3-52; Invitrogen) was grown in synthetic dextrose medium (5 mL ...
-
bioRxiv - Cancer Biology 2020Quote: ... The ligated vectors were transformed into Stbl3 strain of Escherichia coli (Thermo Fisher Scientific, Waltham, MA) and selected with 100 µg/mL ampicillin on LB/agar plates ...
-
bioRxiv - Biophysics 2021Quote: ... ZIKV strain UniProt ID: A0A024B7W1) (NH2-AARAAQKRTAAGIMKNPVVDGIVVTDIDMTIDPQVEKK-COOH) with 96% purity was purchased from Thermo scientific USA and dissolved in buffer consisting of 20 mM sodium phosphate buffer (pH 7.4) ...
-
bioRxiv - Microbiology 2020Quote: ... The purified plasmids harboring the genes of interest were transformed into yeast strain INVSc1 (ThermoFisher Scientific) for protein expression and purification ...
-
bioRxiv - Cell Biology 2021Quote: Leishmania mexicana (MNYC/BZ/62/M379) derived strains were grown at 25°C in HOMEM (Gibco) supplemented with 10% (v/v ...
-
bioRxiv - Biophysics 2020Quote: ... Freshly prepared competent cells of a strain of Pichia pastoris SMD 1163 (Δhis4 Δpep4 Δprb1, Invitrogen) were electro-transformed with individually PmeI-HF (New England Biolabs ...
-
bioRxiv - Developmental Biology 2022Quote: Mouse zygotes (C57BL6/N strain) were injected with 200 ng/µL Cas9 protein (IDT and ThermoFisher), 100 ng/µL Fzd2-specific sgRNA (GCAAGACACTGCACTCGTGG) ...
-
bioRxiv - Genomics 2022Quote: ... vector and amplified in DH5α strain of Escherichia coli (E coli) (Life Technologies, Grand Island NY). After amplification ...
-
bioRxiv - Microbiology 2021Quote: ... coli strains were grown for 24 h at 37°C in 10 mL DMEM-HEPES (Gibco), resuspended in 500µL HBSS (Invitrogen ...
-
bioRxiv - Biophysics 2020Quote: Plasmodium falciparum strains W2 and 3D7 were cultured in 50 mL flasks containing RPMI (Thermo Fisher #31800089 ...
-
bioRxiv - Plant Biology 2019Quote: ... coli strain K12 with JCAT (Grote et al., 2005) (http://www.jcat.de/) and synthesized by Thermo Fisher Scientific (Table S3) ...
-
bioRxiv - Biochemistry 2021Quote: ... pastoris strain GS115 and the Pichia expression vector (pPIC9K) were obtained from Invitrogen (Carlsbad, CA, USA). Bovine trypsin ...
-
bioRxiv - Synthetic Biology 2021Quote: HEK293T cells (ATCC, strain number CRL-3216) were maintained in Dulbecco’s modified Eagle medium (DMEM, Gibco) supplemented with 10% FBS (Sigma-Aldrich) ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified total RNA for each strain used in Affymetrix GeneChip assays (Affymetrix GeneChip Rat Gene 1.0). Microarrays were processed using an Agilent GeneArray Scanner with Affymetrix Microarray Suite version 5.0.0.032 software.
-
bioRxiv - Synthetic Biology 2021Quote: HEK293T cells (ATCC, strain number CRL-3216) were cultured in Dulbecco’s modified Eagle’s medium (DMEM; Gibco) supplemented with 10 % FBS (Sigma-Aldrich) ...
-
bioRxiv - Cell Biology 2021Quote: ... All HTM cell strains were validated with dexamethasone (DEX; Fisher Scientific, Waltham, MA, USA; 100 nM) induced myocilin (MYOC ...
-
bioRxiv - Developmental Biology 2021Quote: Escherichia coli (E. coli) strain DH5α (Toyobo, Osaka, Japan) and BL21(de3) pLysS (C606003, ThermoFisher Scientific) were used for DNA cloning and protein expression ...
-
bioRxiv - Microbiology 2020Quote: ... DNA samples from each strain were extracted using a MAGnify Chromatin Immuno-precipitation System (Invitrogen, USA) according to the manufacturer’s protocol with a modification ...
-
bioRxiv - Microbiology 2021Quote: ... Indicated strains were inoculated to an OD600 of 0.1 in 25 mL CO2-independent medium (Gibco) or 25 mL CO2-independent medium supplemented with 250 μM BCS and cultivated for 3d at 37°C ...