Labshake search
Citations for Thermo Fisher :
201 - 250 of 10000+ citations for Leucine Rich Repeats And Immunoglobulin Like Domains Protein 3 LRIG3 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2023Quote: ... The barrier function of the Calu-3 monolayer was terminally evaluated via immunofluorescence imaging of tight junction protein 1 (ZO-1 antibody, Invitrogen, 339194) and permeability assays using 500 µL of 2 mg/mL FITC-dextran (4 kDa ...
-
bioRxiv - Immunology 2020Quote: The Fab fragments for anti-SARS-CoV-2 antibodies ION_300 and ION_360 and SARS-CoV-2 receptor binding domain (RBD) were expressed in Expi293F™ cells (Thermo Fisher, A14527). The antibody:RBD complexes were mixed and co-purified by size exclusion chromatography in 20 mM Tris-HCl (pH 7.5 ...
-
bioRxiv - Microbiology 2023Quote: ... directed against the cytoplasmic domain of E-cad and revealed using an anti-mouse IgG (H+L) secondary antibody (Alexa Fluor 555) (Life Technologies). The 4’,6’-diamino-2-fenil-indol (DAPI ...
-
bioRxiv - Cell Biology 2023Quote: ... to detect HA-tagged TRPM2 channel domain and the lower part of the membrane was incubated with rabbit-anti-FLAG (DYKDDDDK) antibody (1:1000; 701629; Invitrogen, USA) to detect FLAG-tagged NUDT9H domain and NUDT5 ...
-
bioRxiv - Cell Biology 2023Quote: ... 50 µl of a 1:100 dilution of the AF488 goat anti-alpaca secondary antibody was used (Jackson Immunoresearch 0.25MG Alexa Fluor 488-AffiniPure Goat Anti-Alpaca IgG, VHH domain, from Fisher Scientific). For all cases ...
-
bioRxiv - Neuroscience 2019Quote: ... together with 3 μL prestained protein ladder (ThermoFisher Scientific, 26619). The gels were run at 70 mV for 3 hours ...
-
bioRxiv - Microbiology 2020Quote: ... Toll-like Receptor (TLR) 4 (Thermo Fisher Scientific, Waltham, MA, USA, 1:2000), TLR7 (Thermo Fisher Scientific ...
-
bioRxiv - Microbiology 2022Quote: Human monocyte-like U937 cells (ATCC) were maintained in RPMI1640+GlutaMAX™ (Gibco) supplemented with 10% heat inactivated foetal bovine serum (FBS ...
-
bioRxiv - Immunology 2020Quote: ... small Ubiquitin-Like Modifier (SUMO) protease (1 unit, 12588-018, Life Technologies, USA) was added to the reaction buffer (50 mM Tris-HCl ...
-
bioRxiv - Physiology 2022Quote: ... β-like- cell clusters derived from iPSCs were dissociated using TrypLE Express (ThermoFisher) as described 47 ...
-
bioRxiv - Immunology 2023Quote: ... MALP-like cells were identified as the ADRB2highCD106+ population (using unconjugated ADRB2, Thermofisher, Cat ...
-
bioRxiv - Cell Biology 2023Quote: ... 2 μM DDR1 (Fisher Scientific, discoidin domain receptor 1 inhibitor). Time lapse images were acquired every 10 minutes for 24 hours.
-
bioRxiv - Microbiology 2020Quote: ... tuberculosis cells were cultured in 7H9-rich medium consisting of 7H9 broth (ThermoFisher, DF0713-17-9) with 0.05% Tween-80 (ThermoFisher ...
-
bioRxiv - Plant Biology 2021Quote: ... Antibody-coated Protein A Dynabeads (Invitrogen) were incubated 12 hours at 4 °C with the samples ...
-
bioRxiv - Plant Biology 2023Quote: ... Antibody-coated Protein A Dynabeads (Invitrogen) were incubated 12 h at 4°C with the samples ...
-
bioRxiv - Microbiology 2021Quote: ... The membranes were washed three times with TBST and then were incubated for 1h with a horseradish peroxidase labeled immunoglobulin G (IgG-HRP) secondary antibody (Thermo Fisher Scientific, no. 31430) at 1:7500 dilution ...
-
bioRxiv - Pathology 2020Quote: ... Horseradish peroxidase (HRP)-conjugated goat anti-mouse immunoglobulin (1:2000 dilution, Thermo Scientific) or HRP-conjugated goat anti-rabbit immunoglobulin (1:2000 dilution ...
-
bioRxiv - Cell Biology 2021Quote: ... Alexa Fluor 405 goat anti-mouse immunoglobulin (IgG) 1:500 (Thermo Fisher Scientific) and Alexa Fluor 568 goat anti-guinea pig IgG 1:500 (Thermo Fisher Scientific ...
-
bioRxiv - Bioengineering 2023Quote: ... and included Alexa-Fluor 488 labeled immunoglobulin (IgG, Thermo Fisher Scientific, Waltham, MA), Alexa-Fluor 555 labeled Bovine Serum Albumin (BSA ...
-
bioRxiv - Immunology 2023Quote: ... immunoglobulin genes were reverse-transcribed with Superscript III (Thermo Fisher Scientific, Waltham, MA) using random hexamer oligonucleotides as primers ...
-
bioRxiv - Cell Biology 2019Quote: ... 10 mg of total protein lysate were incubated for 3 h with protein A Dynabeads (Invitrogen) and 10 μg of MST2 antibody (ab52641 ...
-
bioRxiv - Plant Biology 2024Quote: ... Protein extracts (30 µg protein) were loaded on 3-8% Novex Nupage Tris-Acetate gel (Invitrogen) and run for 1 h at 190 V in Novex Nupage (Invitrogen) ...
-
bioRxiv - Microbiology 2021Quote: Total RNA was extracted from mycelia from three biological repeats using the TRIzol (Invitrogen, USA) reagent according to the manufacturer’s instruction ...
-
bioRxiv - Neuroscience 2023Quote: ... and by Repeat-Primed PCR using 2X Phusion Flash High-Fidelity PCR Mastermix (Thermo Fisher). End-point PCR was achieved by amplifying across the repeat region where the presence of a single band at the expected size indicated a non-expanded Wild-Type locus ...
-
bioRxiv - Genetics 2021Quote: ... the same procedure was used except that 20 ug of α-HA antibody (MBL 180-3) was bound to 400 ul equilibrated Protein A agarose (Invitrogen, 15918014) by rotating at room temperature for 1h and washed 3x with extraction buffer and protein was eluted 3x with 300 ul of 1 mg/mL HA peptide (ThermoFisher ...
-
bioRxiv - Cell Biology 2024Quote: ... Antibody-mediated inhibition of hNR-EVs was performed with a commercial antibody that recognizes an extracellular topological domain of PLP1 at its N terminus (AA 36 to 85, Invitrogen, PA5-40788) incubating hNR-EVs with anti-PLP1 1.25 ug/ml for 15 min ...
-
bioRxiv - Biophysics 2024Quote: The DNA sequence of parallel Leucine zipper pair GCN4_v4 (LZ, IASRMKQLEDKVEELLSKNYHLENEVARLKKLVGECEGL) and GCN4_v4 with SNAP tag (LZ-SNAP) were customised by GeneArt (Invitrogen) into pMA plasmids ...
-
bioRxiv - Cell Biology 2022Quote: Rich medium (Yeast Peptone Dextrose, YPD) consisted of 1% yeast extract (Thermo Fisher Scientific, product number 212750), 2% peptone (Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2024Quote: Microscope samples were prepared by sandwiching agarose gel pads (rich, defined media with 2 % Invitrogen UltraPure agarose) of approximately 100 µL between microscope slides and acid-cleaned #1.5H coverslips (Marienfeld) ...
-
bioRxiv - Developmental Biology 2020Quote: ... 40 ng/ml insulin-like growth factor-1 (Pepro Tech) and penicillin-streptomycin (Invitrogen). After 1 day of culture ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: Formalin and (-)-quinpirole HCl (D2-like agonist) were obtained from Fisher Scientific (Waltham, MA) and Sigma-Aldrich (St ...
-
bioRxiv - Cell Biology 2021Quote: ... recombinant human insulin-like growth factor 1 (hIGF1; 100 ng/mL; Thermo Fisher Scientific), holo-transferrin (200 µg/mL ...
-
bioRxiv - Cancer Biology 2022Quote: ... Capillary-like tubes were then stained with cell-permeable dye Calcein AM (ThermoFisher, C1430) and imaged by fluorescence microscopy.
-
bioRxiv - Cancer Biology 2019Quote: ... Primary GBM stem-like cell lines (RNS) were grown in DMEM/Ham’s:F12 (Life Technologies) supplemented with B27 and N2 additives (Life Technologies) ...
-
bioRxiv - Physiology 2019Quote: ... PCR probe for Cela1 (chymotrypsin-like elastase family, member 1) was purchased from ThermoFisher (Applied Biosystems ...
-
bioRxiv - Neuroscience 2023Quote: ... and 1.3 nM human insulin-like growth factor 1 (hIGF-1, Thermo Fisher Scientific). The growth media were changed after 24 h and further regularly changed every 4 days ...
-
bioRxiv - Biochemistry 2022Quote: HIV-1 virus-like particles (VLPs) were produced by Lipofectamine 3000 (Thermo Fisher Scientific) transfection of 293FT cells (purchased from Invitrogen ...
-
bioRxiv - Molecular Biology 2020Quote: ... or 3%-8% NuPAGE Tris-Acetate Protein Gels (Thermo Fisher Scientific) for high molecular weight proteins ...
-
bioRxiv - Cell Biology 2019Quote: ... NativePAGE™ 3-12% Bis-Tris Protein Gels (cat#: BN1001BOX, Invitrogen) and NativePAGE™ Running Buffer Kit (cat# ...
-
bioRxiv - Neuroscience 2020Quote: ... Gradient gels (3% - 8% Tris-acetate protein gels, Thermo Fisher Scientific) were loaded with the lysates and run for 55 min at 150 V in Tris-tricine buffer (50 mM Tris ...
-
bioRxiv - Neuroscience 2021Quote: ... 3) depletion of top 12 abundant serum proteins (Thermo Fisher 85165) according to manufacturer instructions ...
-
bioRxiv - Physiology 2021Quote: ... Native PAGE Novex 3%–12% Bis-Tris Protein Gels (Life Technologies) were loaded with 100-300 μg extracts ...
-
bioRxiv - Microbiology 2020Quote: ... and run on 3-12% NativePage Bis-Tris Protein Gels (Invitrogen) according to manufacturer specifications ...
-
bioRxiv - Cell Biology 2021Quote: Proteins were resolved by Tris-acetate NOVEX NuPAGE 3-8% (Invitrogen) (SorLAFL and SorLA2131 ...
-
bioRxiv - Cancer Biology 2023Quote: ... Protein lysates were resolved on 3-8% (Thermo Fisher Scientific EA0375BOX) or 4-12% gradient SDS-PAGE gels (Thermo Fisher Scientific NP0321BOX) ...
-
bioRxiv - Microbiology 2023Quote: ... with either 3 ul HiMark Pre-Stained Protein Standard (Thermo Fisher) for LapA or 3 ul Spectra Multicolor High Range Protein Ladder (Thermo Fisher ...
-
bioRxiv - Cancer Biology 2021Quote: ... NC1 domain was digested with trypsin (MS Grade, Thermo Fisher Scientific) overnight at 37 °C and then analyzed by LC-MS analysis on a Shimadzu UFLC 20ADXR HPLC system in-line with an AB Sciex 5600 Triple TOF mass spectrometer (AB SCIEX ...
-
bioRxiv - Cell Biology 2020Quote: ... and 500 μg of protein lysate was precleared with 3 μL of Dynabeads protein G (Thermo Fisher) for 1 (HEK 293T lysates ...
-
bioRxiv - Developmental Biology 2022Quote: ... Proteins were separated using NuPAGE 3–8% Tris-Acetate Protein Gels (Life Technologies/Gibco®, Karlsruhe, Germany). For the detection of fibronectin ...
-
bioRxiv - Developmental Biology 2022Quote: ... Proteins were separated using NuPAGE 3–8% Tris-Acetate Protein Gels (Life Technologies/Gibco®, Karlsruhe, Germany). For the detection of fibronectin ...