Labshake search
Citations for Thermo Fisher :
801 - 850 of 10000+ citations for Zika Virus NS1 Protein Uganda strain since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2024Quote: ... and 2 U/µl of M-MulV-RT (Reverse transcriptase of Moloney Murine Leukemia Virus; Thermo Scientific, USA).
-
bioRxiv - Genomics 2024Quote: ... Virus was produced by transfecting HEK293T cells with the plasmid and the Lipofectamine 3000 kit (Thermo Fisher Scientific). U87MG were transduced with the supernatant containing the NY-ESO-1 virus ...
-
bioRxiv - Microbiology 2024Quote: ... and CC81 (feline cell line transformed by mouse sarcoma virus ECACC 90031403) cells were grown in Dulbecco’s modified Eagle’s medium (DMEM)-high glucose (GlutaMAX, Gibco) supplemented with 1% penicillin/streptomycin and 10% fetal bovine serum (Gibco ...
-
bioRxiv - Bioengineering 2024Quote: ... Virus production medium contained DMEM supplemented with L-glutamine and sodium pyruvate and 10% heat-inactivated FBS (Gibco). Viral supernatants collected roughly 48- and 72-hours post-transfection were sterile-filtered through a 0.45-micron filter and concentrated in 100kDa molecular weight cutoff filters.
-
bioRxiv - Immunology 2022Quote: Protein-protein crosslinking using BMOE (Thermo Scientific) was carried out according to the product manual ...
-
bioRxiv - Developmental Biology 2021Quote: ... Protein A and Protein G Dynabeads (Invitrogen) were incubated for 6 hours at 4°C with 5 μg H3K27me3 (07-449 ...
-
bioRxiv - Plant Biology 2023Quote: ... Protein A and Protein G Dynabeads (Invitrogen) were added and incubated at 4 °C for 2 hours with rotation ...
-
bioRxiv - Immunology 2022Quote: ... Protein A or protein G Dynabeads (Invitrogen) were prepared according to manufacturer’s protocol ...
-
bioRxiv - Genomics 2022Quote: ... Protein A and Protein G Dynabeads (Invitrogen) premixed at 1:1 ratio were used for pre-clearing for 1 hour at 4°C ...
-
bioRxiv - Biochemistry 2023Quote: Protein-protein crosslinking using BMOE (Thermo Scientific) was carried out according to the product manual ...
-
bioRxiv - Immunology 2020Quote: ... Precipitated proteins were bound to 50:50 Protein A: Protein G Dynabeads (Invitrogen) for one to two hours and washed extensively with IP wash buffer (50 mM Tris pH 8 ...
-
bioRxiv - Cell Biology 2023Quote: ... Proteins were incubated with fast-flow protein G- or protein A-Dynabeads (Invitrogen) for 2 hours and centrifuged to eliminate nonspecifically bound proteins ...
-
bioRxiv - Developmental Biology 2021Quote: Escherichia coli (E. coli) strain DH5α (Toyobo, Osaka, Japan) and BL21(de3) pLysS (C606003, ThermoFisher Scientific) were used for DNA cloning and protein expression ...
-
bioRxiv - Molecular Biology 2021Quote: ... Genomic DNA of the test strains was digested by NotI restriction enzyme (Gibco-BRL, Gaithersburg, MD) and Salmonella enterica serovar Braenderup was digested using XbaI ...
-
bioRxiv - Developmental Biology 2020Quote: RNA was collected from indicated strains as well as from RNAi treatments using TRIZOL Reagent (Invitrogen). Three biological replicates ...
-
bioRxiv - Molecular Biology 2021Quote: RNA from indicated strains was extracted from mixed stage populations of animals using TRIzol reagent (Invitrogen), then alcohol precipitated ...
-
bioRxiv - Biochemistry 2020Quote: ... Saccharomyces cerevisiae strain InvSc1 (MATa adc2-1 his3-11,15 leu2-3,112 trp1-1 ura3-52; Invitrogen) was grown in synthetic dextrose medium (5 mL ...
-
bioRxiv - Cancer Biology 2020Quote: ... The ligated vectors were transformed into Stbl3 strain of Escherichia coli (Thermo Fisher Scientific, Waltham, MA) and selected with 100 µg/mL ampicillin on LB/agar plates ...
-
bioRxiv - Biophysics 2021Quote: ... ZIKV strain UniProt ID: A0A024B7W1) (NH2-AARAAQKRTAAGIMKNPVVDGIVVTDIDMTIDPQVEKK-COOH) with 96% purity was purchased from Thermo scientific USA and dissolved in buffer consisting of 20 mM sodium phosphate buffer (pH 7.4) ...
-
bioRxiv - Microbiology 2020Quote: ... The purified plasmids harboring the genes of interest were transformed into yeast strain INVSc1 (ThermoFisher Scientific) for protein expression and purification ...
-
bioRxiv - Cell Biology 2021Quote: Leishmania mexicana (MNYC/BZ/62/M379) derived strains were grown at 25°C in HOMEM (Gibco) supplemented with 10% (v/v ...
-
bioRxiv - Biophysics 2020Quote: ... Freshly prepared competent cells of a strain of Pichia pastoris SMD 1163 (Δhis4 Δpep4 Δprb1, Invitrogen) were electro-transformed with individually PmeI-HF (New England Biolabs ...
-
bioRxiv - Genomics 2022Quote: ... vector and amplified in DH5α strain of Escherichia coli (E coli) (Life Technologies, Grand Island NY). After amplification ...
-
bioRxiv - Microbiology 2021Quote: ... coli strains were grown for 24 h at 37°C in 10 mL DMEM-HEPES (Gibco), resuspended in 500µL HBSS (Invitrogen ...
-
bioRxiv - Biophysics 2020Quote: Plasmodium falciparum strains W2 and 3D7 were cultured in 50 mL flasks containing RPMI (Thermo Fisher #31800089 ...
-
bioRxiv - Plant Biology 2019Quote: ... coli strain K12 with JCAT (Grote et al., 2005) (http://www.jcat.de/) and synthesized by Thermo Fisher Scientific (Table S3) ...
-
bioRxiv - Biochemistry 2021Quote: ... pastoris strain GS115 and the Pichia expression vector (pPIC9K) were obtained from Invitrogen (Carlsbad, CA, USA). Bovine trypsin ...
-
bioRxiv - Synthetic Biology 2021Quote: HEK293T cells (ATCC, strain number CRL-3216) were maintained in Dulbecco’s modified Eagle medium (DMEM, Gibco) supplemented with 10% FBS (Sigma-Aldrich) ...
-
bioRxiv - Neuroscience 2021Quote: ... Purified total RNA for each strain used in Affymetrix GeneChip assays (Affymetrix GeneChip Rat Gene 1.0). Microarrays were processed using an Agilent GeneArray Scanner with Affymetrix Microarray Suite version 5.0.0.032 software.
-
bioRxiv - Synthetic Biology 2021Quote: HEK293T cells (ATCC, strain number CRL-3216) were cultured in Dulbecco’s modified Eagle’s medium (DMEM; Gibco) supplemented with 10 % FBS (Sigma-Aldrich) ...
-
bioRxiv - Cell Biology 2021Quote: ... All HTM cell strains were validated with dexamethasone (DEX; Fisher Scientific, Waltham, MA, USA; 100 nM) induced myocilin (MYOC ...
-
bioRxiv - Developmental Biology 2021Quote: Escherichia coli (E. coli) strain DH5α (Toyobo, Osaka, Japan) and BL21(de3) pLysS (C606003, ThermoFisher Scientific) were used for DNA cloning and protein expression ...
-
bioRxiv - Microbiology 2020Quote: ... DNA samples from each strain were extracted using a MAGnify Chromatin Immuno-precipitation System (Invitrogen, USA) according to the manufacturer’s protocol with a modification ...
-
bioRxiv - Microbiology 2021Quote: ... Indicated strains were inoculated to an OD600 of 0.1 in 25 mL CO2-independent medium (Gibco) or 25 mL CO2-independent medium supplemented with 250 μM BCS and cultivated for 3d at 37°C ...
-
bioRxiv - Immunology 2020Quote: ... Both RSV strains were propagated on HEp-2 cells (ATCC, CCL-23) cultured in DMEM (Gibco) supplemented with 5% FBS (Gibco) ...
-
bioRxiv - Immunology 2022Quote: Listeria monocytogenes EGD (BUG600 strain) was grown in brain heart infusion (BHI) broth (#10462498, Fisher Scientific) shaking at 37□°C ...
-
bioRxiv - Genomics 2022Quote: The 42 Kluyveromyces lactis strains were inoculated into flat bottom 96-well microplates (Nunclon, Thermo Fisher) containing 150 μL of YPD (Yeast extract 1% Peptone 2% Dextrose 2% ...
-
bioRxiv - Microbiology 2022Quote: ... coli XL1-Blue strain cultured in Luria-Bertani (LB) broth (Thermo Fisher Scientific, Waltham, MA, USA) aerobically at 37°C ...
-
bioRxiv - Microbiology 2022Quote: ... The strain was maintained in complete 7H9 media supplemented with 30 μg/ml kanamycin (Fisher Scientific). Mtb mc26206 expressing tdTomato (Mtb-RFP ...
-
bioRxiv - Microbiology 2023Quote: ... aureus (HIP10787 mupA positive QC strain Methycilin Resistant) sourced from Thermo Scientific (LENEXA, KS 66215 USA) were independently inoculated into a 10 ml Luria Broth (LB ...
-
bioRxiv - Microbiology 2023Quote: ... genomic DNA from each strain was quantified using the Qubit DNA Broad Range assay (ThermoFisher Scientific), diluted to the same concentration (10 ng/μL ...
-
bioRxiv - Biophysics 2023Quote: The hpt1Δ (MatA, his3Δ1, leu2Δ0, met15Δ0, ura3Δ0, hpt1::KanMX) Saccharomyces cerevisiae yeast strain was from Invitrogen. The cells were cultured in synthetic complete (SC ...
-
bioRxiv - Biochemistry 2023Quote: P.pastoris strain X-33 and the vector pPICZα C were purchased from Invitrogen (Thermo Fisher Scientific). E.coli XL-10 cells were provided by STRATAGENE EUROPE.
-
bioRxiv - Microbiology 2023Quote: ... and the ΔmelH complemented strain were determined using a BacLight Bacterial Membrane Potential Kit (ThermoFisher Scientific) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: AJY4049 was made by integrating PmeI-cut pAOL47-04 into a TIF6-GFP-expressing strain (Invitrogen). AJY3027 was constructed by sequential crossing appropriate haploid strains originally derived from the heterozygous deletion collection (Invitrogen) ...
-
bioRxiv - Microbiology 2023Quote: The bacterial strains used in this work unless otherwise stated were as follows DH5α (ThermoFisher Scientific). The plasmids and primers that were used in this study can be found in table 1 ...
-
bioRxiv - Microbiology 2024Quote: Glycerol stock of Escherichia coli (E. coli) (TOP10 strain, Invitrogen, Thermo Fisher Science, Waltham, MA, USA) transformed with plasmid pCR2.1 (Invitrogen ...
-
bioRxiv - Microbiology 2024Quote: ... 2 μl of the respective strain were spotted on a 1% PBS-agarose (select agar, Invitrogen). Fluorescence microscopy was performed as described previously (42) ...
-
bioRxiv - Microbiology 2020Quote: Concentrated live or inactivated virus samples were mixed with Novex™ Tris-Glycine SDS Sample Buffer (2X) (Thermofisher Scientific) with NuPAGE™ Sample Reducing Agent (10X ...
-
bioRxiv - Neuroscience 2020Quote: ... patient-derived fibroblasts were infected with Sendai virus using the CytoTune-iPS 2.0 Sendai Reprogramming Kit (Invitrogen, CA, US) according to the manufacturer’s instruction ...