Labshake search
Citations for Thermo Fisher :
551 - 600 of 10000+ citations for Leucine Rich Repeats And Immunoglobulin Like Domains Protein 3 LRIG3 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2024Quote: ... Antibodies were purified from culture supernatants by protein A agarose beads (Thermo Fisher PierceTM Protein A Agarose, 20333). Briefly ...
-
bioRxiv - Cell Biology 2023Quote: ... siARP2/3 (5’- GGAUUCCAUUGUGCAUCAAtt-3’, 5’-GGGAUGAUGAGACCAUGUAtt-3’, 5’- AAAUCCUAAUGGAGACAAAtt-3’, Ambion)
-
bioRxiv - Physiology 2020Quote: ... and 3) verify functional cutaneous B2R antagonism via CVC and protein extravascularization (BCA protein assay of dialysate; Thermo Scientific, Waltham, MA, USA; Figure 1D). Increases in skin flux (vasodilation ...
-
bioRxiv - Cell Biology 2020Quote: ... 3 % SDS and 5 mM EDTA) and protein concentrations were determined with a Pierce BCA protein assay kit (Thermo Fisher Scientific, Waltham, MA, USA).
-
bioRxiv - Molecular Biology 2021Quote: ... SNO proteins were detected by the anti-TMT antibody (ThermoFisher Scientific).
-
bioRxiv - Genomics 2019Quote: ... Antibody-bound chromatin was incubated with Protein G Dynabeads (Invitrogen, 10004D) for 4 hours at 4’C and eluted in Tris buffer (10mM Tris pH 8.0 ...
-
bioRxiv - Neuroscience 2019Quote: ... in combination with protein-specific antibodies (rabbit anti-RapGEF4 from Invitrogen, 1:250 ...
-
bioRxiv - Molecular Biology 2019Quote: ... FLAG (M2) antibody was coupled to protein G dynabeads (Thermo Scientific). The RNA-protein complexes were immunoprecipitated over night at 4°C ...
-
bioRxiv - Biochemistry 2019Quote: ... or H3 antibody (pulled-down using protein G-coupled Dynabeads; Invitrogen) and eluted in buffer D containing 1% SDS by end-over-end rotation at room temperature for 2 × 10 min ...
-
bioRxiv - Genetics 2020Quote: ... Chromatin–Antibody complexes were precipitated with Dynabeads Protein A beads (Invitrogen) and washed sequentially with low-salt (20 mM Tris–HCl (pH 8.1) ...
-
bioRxiv - Biochemistry 2021Quote: ... antibody serum was pre-incubated with Protein G coupled dynabeads (Invitrogen) in 1:1 ratio for 2h at 4°C on a rotating wheel ...
-
bioRxiv - Systems Biology 2021Quote: ... Bait proteins were detected with the anti-HA antibody (Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2019Quote: The anti-HRI antibody was conjugated with Dynabeads (protein G, Invitrogen) o.n ...
-
bioRxiv - Plant Biology 2022Quote: ... The chromatin-antibody complex was recovered with protein A Dynabeads (Invitrogen) and washed ...
-
bioRxiv - Cell Biology 2022Quote: ... HRP conjugated secondary antibodies against mouse proteins were obtained from ThermoFisher and used at 1:5000 dilution.
-
bioRxiv - Immunology 2022Quote: ... The conjugated antibodies were quantitated for protein content by Nanodrop (Thermofisher). Prior to storage at 4°C ...
-
bioRxiv - Genetics 2020Quote: ... 10 µg of antibody was bound to Dynabeads Protein A (Invitrogen) following manufacturer guidelines at 4 °C for 4 h ...
-
bioRxiv - Cell Biology 2021Quote: ... Primary antibodies were first incubated with protein G Dynabeads (Invitrogen, 10003) at room temperature for 10 min on a rotator ...
-
bioRxiv - Immunology 2020Quote: ... Antigen–antibody complexes were captured with Protein G-coupled Dynabeads (Invitrogen) and re-suspended in gel loading buffer containing 2% SDS ...
-
bioRxiv - Immunology 2021Quote: ... or control rabbit IgG antibody and protein G beads (Invitrogen, 10003D) overnight at 4 °C while rotating ...
-
bioRxiv - Molecular Biology 2022Quote: ... Chromatin/antibody complexes were recovered with DynabeadsTM Protein A (Invitrogen, 10002D) followed by extensive sequential washes with 150 mM ...
-
bioRxiv - Developmental Biology 2022Quote: ... The antibodies against the proteins of interest (ZP3, Anti-ZP3: Invitrogen Catalog # PA5-89033 ...
-
bioRxiv - Plant Biology 2023Quote: ... proteins were then mixed with anti-FLAG antibody (Thermal Fisher Scientific) for 1 h at 4 °C and incubated with protein-G magnetic beads (Bio-rad ...
-
bioRxiv - Biochemistry 2023Quote: ... were incubated with primary antibody bound Protein-G Agarose bead (Invitrogen) and rotated overnight at 4⁰C ...
-
bioRxiv - Immunology 2023Quote: ... Anti-flag antibody was pre-incubated with protein G Dynabeads (Invitrogen), and equal amounts of protein from lysate were incubated with 5 μg anti-FLAG antibody (Roche ...
-
bioRxiv - Cell Biology 2023Quote: ... antibodies were bound to Dynabead Protein A/G beads (ThermoFisher Scientific) for 10 min at room temperature and ∼ 5 hr at 4oC ...
-
bioRxiv - Microbiology 2023Quote: Antibody concentrations were determined using the Qubit Protein Assay Kit (ThermoFisher). The GloMelt™ Thermal Shift Protein Stability Kit (Biotum ...
-
bioRxiv - Cell Biology 2023Quote: ... antibody was conjugated to Dynabeads Protein G (Thermo Fisher Scientific 10003D) at room temperature for 2 hr ...
-
bioRxiv - Molecular Biology 2024Quote: ... antibody coupled to Dynabeads™ Protein G (Thermo Fisher Scientific, 10002D). Co-purified ...
-
bioRxiv - Physiology 2023Quote: ... Proteins of interest were detected using antibodies against GFP (A6455, Invitrogen) and Histone H3 (ab1791 ...
-
bioRxiv - Molecular Biology 2020Quote: ... or T50E proteins were diluted to 3 µg/ml in Dulbecco’s phosphate-buffered saline (PBS; Gibco) containing 0.1% BSA and 0.02% Tween-20 and immobilized on NTA capture sensors (FortéBio) ...
-
bioRxiv - Bioengineering 2021Quote: ... 300 ng of gRNA was mixed with 3 µg of the True Cut Cas9 Protein (Invitrogen) in 12 µL of buffer R from the Neon Transfection System and incubated for 10 min at room temperature ...
-
Enzymatic RNA Biotinylation for Affinity Purification and Identification of RNA-protein InteractionsbioRxiv - Biochemistry 2020Quote: ... HeLa cell pellets (∼3×106) were lysed with 500 µL Mammalian Protein Extraction Reagent (Thermo Scientific), supplemented with 2X HALT protease inhibitor (Thermo Scientific) ...
-
bioRxiv - Genetics 2022Quote: ... the samples were run on the NuPAGE™ 3-8% Tris-Acetate Protein Gel (Invitrogen, EA03785) at 160 V for 1.5 hours on ice ...
-
bioRxiv - Cancer Biology 2019Quote: ... followed by 3–4-hour incubation at 4°C with protein A/G agarose (20421, Invitrogen). The beads were then collected for western blot detection ...
-
bioRxiv - Cancer Biology 2019Quote: ... Ten micrograms of proteins were loaded and run on NuPAGE 3-8% Tris-Acetate (ThermoFisher Scientific) before being transferred onto 0.45 µm PVDF membrane (Merck) ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: Proteins in lysates (10 μg) were analyzed by electrophoresis on 3-8% SDS-polyacrylamide gels (ThermoFisher) and subsequently transferred to a nitrocellulose membrane (Bio-Rad) ...
-
bioRxiv - Cancer Biology 2021Quote: Proteins were extracted by TCA method and resolved on 3-8% Tris Acetate NuPAGE (Thermo Scientific) in reducing conditions (NuPAGE Tris Acetate SDS running buffer – Thermo Scientific ...
-
bioRxiv - Microbiology 2022Quote: ... the mixture was incubated with 3 μl of Dynabeads™ Protein G magnetic beads (ThermoFisher Scientific). After 1 hr rotation at 4°C ...
-
bioRxiv - Plant Biology 2023Quote: ... Samples were loaded on a NativePAGE™ 3-12% Bis-Tris Protein Gel (Thermo-Fisher Scientific) alongside a NativeMark™ Unstained Protein Standard (Thermo-Fisher Scientific) ...
-
bioRxiv - Genomics 2023Quote: ... at 4°C for 3 hours followed by addition of 10 ml Protein A Dynabeads (Invitrogen) for 20 min to capture the antibody-protein complexes ...
-
bioRxiv - Cancer Biology 2023Quote: ... Cell lysates were separated by SDS-PAGE electrophoresis (NuPAGE 3-8%TRIS acetate protein gels (Invitrogen) or 4-20% Mini-PROTEAN TGX protein gel (Bio-Rad)) ...
-
bioRxiv - Biochemistry 2021Quote: ... The chemically synthesized p53 TAD2 domain peptide (38QAMDDLMLSPDDIEQWFTEDPGPD61) was obtained with >90% purity from Thermo Scientific, USA ...
-
bioRxiv - Molecular Biology 2021Quote: ... the gene encoding PDGFR transmembrane domain was amplified by PCR using pDisplay vector (Thermo Fisher Scientific) as a template ...
-
bioRxiv - Developmental Biology 2020Quote: Robo1 domain deletions were generated via site-directed mutagenesis using Phusion Flash PCR MasterMix (Thermo Scientific), and completely sequenced to ensure no other mutations were introduced ...
-
bioRxiv - Bioengineering 2022Quote: ... The gene encoding PDGFR transmembrane domain was amplified by PCR using pDisplay vector (Thermo Fisher Scientific) as a template ...
-
bioRxiv - Immunology 2022Quote: Sequences for VH and VL domains were codon optimized using GeneArt (Thermo Fisher Scientific, Waltham, MA) and gene blocks for each domain were purchased from Integrated DNA Technologies (IDT ...
-
bioRxiv - Microbiology 2023Quote: ... followed by an incubation with mouse anti-human E-cad cytoplasmic domain mAb (4A2C7, Life Technologies). In some experiments ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Bioengineering 2023Quote: ... The novel PTGFRN transmembrane domain display systems were codon optimized and DNA synthesized by Thermo Fisher. All plasmids were sequence-verified ...