Labshake search
Citations for Thermo Fisher :
451 - 500 of 10000+ citations for L Leucine N T Boc H2O 13C6 97 99%; 15N 97 99% since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2020Quote: ... and 10 μL nuclease-free distilled H2O (ThermoFisher Scientific). The PCR reaction was then incubated in a PCR thermocycler using the following conditions ...
-
bioRxiv - Microbiology 2020Quote: ... and 2.9 μL nuclease-free distilled H2O (ThermoFisher Scientific). The qPCR was performed in a Realplex Mastercycler (Eppendorf ...
-
bioRxiv - Molecular Biology 2020Quote: ... 2.25 µl of Nuclease Free H2O (Ambion, Cat#AM9937), 2.2 µl of tris-EDTA (TE ...
-
bioRxiv - Zoology 2022Quote: ... and adult bees were washed (Ultra-Pure H2O, Invitrogen) and placed in separate 1ml microcentrifuge tubes with 150μl of a non-ionic lysis buffer (150mM NaCl ...
-
bioRxiv - Molecular Biology 2023Quote: ... followed by 13mL UltraPure Distilled H2O (cat# 10977015; Invitrogen) for 30 minutes ...
-
bioRxiv - Cancer Biology 2024Quote: ... and resuspended in nuclease-free H2O (AM9939, Life Technologies). RNA concentration was measured by spectrophotometry.
-
bioRxiv - Genomics 2022Quote: ... The 15N-GST-H4 peptide fusion was purified on glutathione agarose resin (Thermofisher Scientific), cleaved with PreScission Protease (16 hr incubation at 4°C) ...
-
bioRxiv - Molecular Biology 2023Quote: ... 25 wt% N,N,N’,N’-tetrakis(2-hydroxypropyl) ethylenediamine (Fisher Scientific, AAL16280AP) and 15 wt% Triton X-100 ...
-
bioRxiv - Neuroscience 2022Quote: ... and 1.5 μl of TEMED (N,N,N’,N’-tetramethylethylenediamine; 15524-010, Invitrogen). A 8 μl drop was quickly deposited onto each 19 mm coverslip ...
-
bioRxiv - Molecular Biology 2020Quote: ... all samples were purified using AmpureXP beads at a volumetric ratio of 0.5X with a final elution in 13 µl of H2O (DNase/RNase-Free Distilled H2O, Thermo Fisher Scientific #10977-049). The cDNA was then quantified using the Qubit High Sensitivity dsDNA Assay Kit (Thermo Fisher Scientific ...
-
bioRxiv - Immunology 2023Quote: ... 10% H2/N2 (BOC) for 3 days on blood agar plates containing 7% laked horse blood (Thermo Scientific) and the Campylobacter selective supplement “Skirrow” containing the antibiotics trimethoprim ...
-
bioRxiv - Molecular Biology 2020Quote: ... After RT we digested all residual oligos using adding 5 µl mastermix of 4 µl nuclease free H2O (DNase/RNase-Free Distilled H2O, Thermo Fisher Scientific #10977-049), 0.5 µl of Exonuclease I (NEB #M0568 ...
-
bioRxiv - Neuroscience 2021Quote: ... was dissolved in cell culture-grade H2O (Invitrogen 10977-015) to make an 80mM solution ...
-
bioRxiv - Neuroscience 2021Quote: ... was dissolved in cell culture-grade H2O (Invitrogen 10977-015) to make an 80mM solution ...
-
bioRxiv - Immunology 2021Quote: Cells were lysed in H2O containing 0.05% SDS (ThermoFisher Scientific). Lysates of Mtb-infected cells were serially diluted in steps of 5-fold in 7H9 broth and 10 μl droplets were spotted onto square Middlebrook 7H10 agar plates ...
-
bioRxiv - Genomics 2019Quote: ... 0.5% SDS in H2O) and 100μg Proteinase K (Invitrogen #25530049) for 30 minutes at 55°C followed by Isopropanol precipitation using GlycoBlue (Invitrogen #AM9516 ...
-
bioRxiv - Developmental Biology 2020Quote: ... cDNA was diluted 1:10 in Nuclease-free H2O (Ambion) and stored at −20°C until use ...
-
bioRxiv - Cell Biology 2019Quote: ... 1.75 µl H2O and 3 µl of Opti-MEM (ThermoFisher) containing 0.4 M sucrose and incubated for 20 min at room temperature (per well protocol) ...
-
bioRxiv - Immunology 2020Quote: ... Isolated RNA was resuspended in RNAse/DNAse free H2O (Invitrogen) and stored at 4°C overnight or −80°C ...
-
bioRxiv - Microbiology 2023Quote: ... an H2O2 solution (35% wt solution in H2O – Fisher Scientific) was dissolved in autoclaved Milli-Q water at a concentration of 25 ...
-
bioRxiv - Systems Biology 2022Quote: ... and 382.5 μL water (H2O, Fisher Scientific, New Hampshire, US). Samples were vortexed and left on ice for 10 minutes to separate into a biphasic mixture ...
-
bioRxiv - Genomics 2024Quote: ... eluted in 30 µl of H2O and Qubit (Thermo Scientific) quantified ...
-
bioRxiv - Microbiology 2024Quote: ... and resuspended in 90 μL RNAse-free H2O (Thermo Fisher).
-
bioRxiv - Biochemistry 2023Quote: ... Samples were diluted in LCMS H2O (W6-4, Fisher Scientific). Plates were read at an absorbance of 562 nm using the Synergy LX Multi-Mode Reader and Gen5 software was used for data analysis (BioTek/Agilent) ...
-
bioRxiv - Biophysics 2021Quote: ... uniformly 13C, 15N-labeled deoxynucleotide triphosphates (dNTPs, Silantes) and/or unlabeled dNTPs (Thermo Fisher Scientific). The reaction mixture was centrifuged to remove excess pyrophosphate ...
-
bioRxiv - Microbiology 2021Quote: ... were washed twice with 300 μL 1X TBS-T (2.4 g Tris-Base, 8 g NaCl, 0.1 % Tween20) using a magnetic stand (ThermoFisher) before coupling them with 200 μl of B domains in TBS at 0.125 ng/ml ...
-
bioRxiv - Bioengineering 2021Quote: ... N,N,N’,N’- tetramethyl ethylenediamine and glycylglycine were purchased from Acros Organics (New Jersey, USA). Protogel 30% acrylamide ...
-
bioRxiv - Microbiology 2021Quote: ... 1,2-Bis(2-aminophenoxy)ethane-N,N,N’,N’-tetraacetic acid tetraacetoxymethyl ester (BAPTA-AM, Invitrogen), calcium Ionophore A23187 (Sigma) ...
-
bioRxiv - Bioengineering 2021Quote: ... N,N′-Diisopropylcarbodiimide (DIC, Fisher Scientific) and 10 equivalents of DIPEA in DMF for 4 h ...
-
bioRxiv - Microbiology 2020Quote: ... The extraction solvent consisted of 30 g/L of tri-n-octylphosphine oxide (TOPO, Acros Organics, Geel, Belgium) in mineral oil (Sigma Aldrich ...
-
bioRxiv - Biochemistry 2019Quote: ... The pre-incubation media was replaced with 13C6-glucose media (DMEM without glucose or glutamine (Gibco) supplemented with 2 mM glutamine and 5 mM 13C6-glucose + 10% dialyzed FBS ...
-
bioRxiv - Cell Biology 2019Quote: ... Specimens were dipped in H2O and mounted in ProLong Gold (Invitrogen). Specimens for fixed TIRF were kept in PBS at 4°C and imaged the same day ...
-
bioRxiv - Biochemistry 2020Quote: ... eluted in molecular biology grade double-distilled H2O (ddH2O, Invitrogen™), and quantified using a NanoDrop spectrophotometer (Thermo Scientific™) ...
-
bioRxiv - Biochemistry 2019Quote: ... The purified RNA sample was dissolved in nuclease-free H2O (Invitrogen).
-
bioRxiv - Genomics 2021Quote: ... Parasite enriched DNA was eluted in 10uL nuclease-free H2O (Ambion). One µl of recovered DNA concentrate was used for DNA quantification using Qubit Fluorimetry (ThermoFisher Scientific ...
-
bioRxiv - Microbiology 2022Quote: ... reduces hydrogen peroxide to H2O using Amplex Red (Invitrogen, United States) as an electron donor ...
-
bioRxiv - Molecular Biology 2023Quote: ... Libraries were eluted in 20 µl of nuclease-free H2O (Ambion), and then quantified using the Qubit dsDNA HS assay (Invitrogen) ...
-
bioRxiv - Microbiology 2024Quote: ... ultrapure BSA 1 mg/mL and DEPC H2O (Thermo Fisher Scientific) and stored at −80°C until use.
-
bioRxiv - Genetics 2024Quote: ... 840 μL DNA grade H2O (Invitrogen Waltham, MA cat no. AM9922), and 50 μL T4 DNA Ligase (NEB cat no.M0202L) ...
-
bioRxiv - Physiology 2022Quote: ... 10 µL of hydrolysate were mixed with 150 µL of isopropanol followed by 75 µL of 1.4% chloramine-T (ThermoFisher) in citrate buffer (pH = 6.0 ...
-
bioRxiv - Bioengineering 2022Quote: ... Final water-PAAm mixtures were crosslinked with 0.5% APS and 0.15% N,N,N′,N′-tetramethylethylenediamine (ThermoFisher, 17919). 50 μL of the mixtures were added to each glass and allowed to crosslink for 30 minutes at room temperature ...
-
bioRxiv - Microbiology 2021Quote: ... small_pMA-T and large_pMA-T (synthesized by Invitrogen). To construct the final plasmid ...
-
bioRxiv - Cell Biology 2020Quote: HEK293T cells stably expressing a single copy of N-terminally tagged TTBK2- or GFP-BirA* were generated using Flp-IN T-REx cells (ThermoFisher K6500-01), Positive clones were selected with hygromycin resistance ...
-
bioRxiv - Biochemistry 2020Quote: pcDNA5-based constructs for the expression of C-terminally His6-PreScission protease cleavage site-2xFlag (Flag)-tagged full-length or N-terminally truncated ASCC3 variants were transfected into HEK293 Flp-In™ T-REx™ cells (Invitrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: ... Hydroxybenzotriazole (HOBt) and O-(benzotriazol-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HBTU) were purchased from Fisher Scientific. Trifluoroacetic acid (TFA ...
-
bioRxiv - Biophysics 2024Quote: The DNA sequence of parallel Leucine zipper pair GCN4_v4 (LZ, IASRMKQLEDKVEELLSKNYHLENEVARLKKLVGECEGL) and GCN4_v4 with SNAP tag (LZ-SNAP) were customised by GeneArt (Invitrogen) into pMA plasmids ...
-
bioRxiv - Cancer Biology 2020Quote: ... the unlabeled medium was replaced with [U-13C6]-glucose medium which composed of low glucose DMEM (Gibco, 11054-020 ...
-
bioRxiv - Plant Biology 2020Quote: ... 15N abundance was determined with an Isotope Ratio Mass Spectrometer (IRMS) (delta VAdvantage, Thermo Fisher, Dreieich, Germany) coupled to an Elemental Analyzer (Euro EA ...
-
bioRxiv - Plant Biology 2023Quote: ... and the 15N enrichment using the Delta V Advantage isotope ratio mass spectrometer (Thermo Fisher Scientific, France). Supplementary Table 3 indicates the calculations of different traits with C and N content ...
-
bioRxiv - Biochemistry 2021Quote: ... with a 10-fold excess of N,N’-dimethyl-N-(iodoacetyl)-N’-(7-nitrobenz-2-oxa-1,3-diazol-4-yl) ethylenediamine (IANBD-amide, Molecular Probes). After 90 min on ice ...