Labshake search
Citations for New England Biolabs :
51 - 100 of 10000+ citations for Human Carboxyl Terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein NOS1AP ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Synthetic Biology 2019Quote: ... in 1X terminal transferase reaction buffer (NEB, M0315L) and 0.25 mM CoCl2 (NEB ...
-
bioRxiv - Genetics 2021Quote: ... 4 units Terminal Transferase (New England Biolabs™) and were carried out at 37°C for 30 minutes followed by heat inactivation at 75°C for 10 minutes ...
-
bioRxiv - Biophysics 2021Quote: ... using a terminal transferase (New England BioLabs, M0315S) as described previously.[21] Briefly ...
-
bioRxiv - Cell Biology 2022Quote: ... 4 units Terminal Transferase (New England Biolabs™) and were carried out at 37°C for 30 minutes followed by heat inactivation at 75°C for 10 minutes ...
-
bioRxiv - Microbiology 2022Quote: ... 5 µL terminal transferase (TdT) (NEB, CN M0315L). The reaction was incubated at 37 °C for 1 hour ...
-
bioRxiv - Cell Biology 2024Quote: ... and 0.4 U/μL Terminal Deoxynucleotidyl Transferase (NEB) were mixed in 1× Terminal Transferase Reaction buffer and incubated at 37°C overnight ...
-
bioRxiv - Microbiology 2020Quote: ... The ClbI C-terminal GFP fusion was constructed using the Gibson Assembly kit (New England Biolabs, MA, USA). Briefly ...
-
bioRxiv - Biochemistry 2021Quote: ... The E PBM C-terminal mutation (DVLL>GGGG) was performed using the Q5 site-directed mutagenesis kit (NEB). The sequences corresponding to the PDZ domains were cloned into the pCMV GFP vector using EcoRI and XhoI sites.
-
bioRxiv - Biochemistry 2021Quote: ... also C-terminal) FT MYOC variants were generated by DNA assembly (NEBuilder HiFi DNA Assembly Cloning Kit, NEB) by combining a PCR-amplified eGLuc2 product from a pcDNA3 MYOC eGLuc2 plasmid (originally described previously8) ...
-
bioRxiv - Molecular Biology 2021Quote: ... the commercially available fluorescent ligand SNAP-Cell TMR-Star (New England Biolabs) was used.
-
bioRxiv - Immunology 2022Quote: ... a 1 in 200 dilution of SNAP-Oregon cell permeable ligand (NEB) was added.
-
bioRxiv - Microbiology 2024Quote: ... N-4005, and N-4004) were used to cap available 3’-terminal ends using terminal transferase (1 µl, 20 units) (NEB #M0315S), TdT reaction buffer (1.5 µl) ...
-
bioRxiv - Molecular Biology 2024Quote: ... and cloned into overexpression vectors under act5 promoter with either N-terminal or C-terminal FLAG tags using Gibson Assembly® Master Mix (NEB, E2611L) at 50 °C for 1 hr ...
-
bioRxiv - Cell Biology 2020Quote: ... addition of a N-terminal Hemagglutinin (HA) epitope was done using Q5 Site-Directed Mutagenesis Kit (New England Biolabs) following manufacturer recommendations.
-
bioRxiv - Biochemistry 2024Quote: ... C-terminal Cx36 mutants were generated using the Q5 site directed mutagenesis kit (E0554S; New England Biolabs, Ipswitch, MA) and corresponding primer pairs introducing gaps into the Cx36 coding sequence ...
-
bioRxiv - Genetics 2023Quote: ... which was immediately used as a template for seven synonymous single-nucleotide substitutions into the terminal 21bp of the ZK938.12 gene fragment by Q5 site-directed mutagenesis kit (NEB). The resultant plasmid was named pDSP47.
-
bioRxiv - Biochemistry 2024Quote: ... a vector containing an N-terminal Thioredoxin-His10 tag using a Gibson Assembly® Cloning Kit (New England BioLabs). Plasmids were extracted and transformed into competent E ...
-
bioRxiv - Cancer Biology 2020Quote: ... The synthetic genes encoding WT human TRIM28 with an N-terminal maltose binding protein (MBP) affinity tag (UniProt: Q13263) were subcloned to the pMAL-p2X vector (New England Biolabs, Beverly, MA, USA).
-
bioRxiv - Biochemistry 2022Quote: ... as N-terminal VP16 fusions using HiFi assembly (NEB). The human ERG ETS domain ...
-
bioRxiv - Genomics 2020Quote: ... in 1× terminal deoxynucleotidyl transferase buffer (New England Biolabs). 2.5 fmol of a 50-nucleotide oligomer was included in all reactions as an internal control ...
-
bioRxiv - Cell Biology 2024Quote: ... and 20 U/μL terminal transferase (NEB, no. M0315S). After incubation at 37°C for 30 min and termination at 70°C for 10 min ...
-
bioRxiv - Microbiology 2023Quote: ... C-tailing was performed with Terminal Transferase (NEB #M0315) and 400-800 ng of end repaired gDNA using a 1:20 dCTP:ddCTP mixture (9.5 mM dCTP Millipore Sigma #3732738001 ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 1U of terminal transferase (New England Biolabs #M0315L). The reaction was incubated at 37°C for five minutes ...
-
bioRxiv - Cell Biology 2023Quote: ... were transfected and incubated with 0.5 µM 647-SiR SNAP ligand (S9102S, NEB) and 0.5 µg/ml Hoechst 34580 in DMEM (11965-092 ...
-
bioRxiv - Cell Biology 2019Quote: ... PACRGΔ1-69 was amplified from the GST-PACRGFL plasmid with PCR primers introduced BamHI (N-terminal) and XhoI (C-terminal) restriction sites for ligation in pGEX-6p1 with the T4 DNA ligase (NEB; Suppl. Figure S9). To generate the PACRG:MEIG1 co-expression vector the same protocol was performed as above using restriction enzyme cloning ...
-
bioRxiv - Developmental Biology 2021Quote: ... and NEBNext rRNA Depletion Kit (Human/Mouse/Rat) (NEB) according to the manufacturer’s protocol ...
-
bioRxiv - Developmental Biology 2022Quote: ... and NEBNext rRNA Depletion Kit (Human/Mouse/Rat) (NEB) according to the manufacturer’s protocol ...
-
bioRxiv - Biophysics 2021Quote: ... The AcrIIA4 expression vector was modified to express AcrIIA11 with a C-terminal NLS and HA tags using the HiFi Assembly Kit (NEB).
-
bioRxiv - Molecular Biology 2019Quote: ... where C-terminal Myc-DDK tag was replaced by HIS-V5 tag using a NEBuilder HiFi DNA assembly kit (New England Biolabs). SHIP2 deletion in 293T cells was carried out by CRISPR/Cas9 technology (Ran et al ...
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...
-
bioRxiv - Microbiology 2020Quote: ... A bacteria-codon optimized gBlock for the truncated protein was produced by IDT DNA Technologies and cloned into a pET28a bacterial expression with a C-terminal 6xHis tag using the NEBuilder Assembly Kit (New England Biolabs). Recombinant protein was expressed in BL21(DE3 ...
-
bioRxiv - Biochemistry 2022Quote: ... The library was cloned into a pENTR1A plasmid backbone with a C-terminal YFP HA reporter tag using Gibson Assembly (HiFi DNA Assembly Cloning Kit, New England Biolabs, (NEB), Ipswich ...
-
bioRxiv - Biochemistry 2022Quote: MBOAT7 mutants were generated by site-directed mutagenesis on the pFBM construct expressing MBOAT7 with a C-terminal GFP and strep tag using the Q5 Mutagenesis Kit (New England Biolabs), according to the manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2022Quote: ... and C-terminal truncations (-57Q, -56IQ, -55DIQ and -54DDIQ) were performed on phyg-C-CSNAP-cerulean using the Q5 mutagenesis kit (NEB). HAP1 WT cells were transfected with 5 μg plasmid DNA using JetPRIME (Polyplus) ...
-
bioRxiv - Cell Biology 2023Quote: ... The sequences were cloned into the pUASz1.0 vector (54) with the eGFP ORF at the C-terminal end of the Top3β ORF using a ligation kit (NEB). The UASz vector allows one to induce the constructs in any tissue ...
-
bioRxiv - Immunology 2023Quote: ... pcDNA3.1-FLAG-ZBTB48 WT was used as template for the generation of the constructs with point mutations in the C-terminal arm using the primers in Table S6 and the Q5 Site-Directed Mutagenesis Kit (NEB). In brief ...
-
bioRxiv - Biophysics 2023Quote: ... The full length KIF5B in pACEBac1 was replaced with a C-terminal TEV-Twin-Strep-tag via HIFI DNA assembly kit (NEB). The TRAK1 construct was made through assembling His-ZZ-TEV-SNAP tag and TRAK1(1-395 ...
-
bioRxiv - Biochemistry 2024Quote: ... with C-terminal TEV, GFP, 7xHis, and StrepII (Thawani et al., 2020) using the Q5 Site Directed Mutagenesis Kit (NEB). All three constructs were expressed using the Bac-to-Bac Sf9 cell expression system (Invitrogen) ...
-
bioRxiv - Molecular Biology 2024Quote: PCR products amplifying the C-terminal region of CBP in both edited and unedited cells were cleaned up using the Monarch PCR cleanup kit (NEB). DNA concentrations were measured using the Qubit dsDNA BR kit (ThermoFisher ...
-
bioRxiv - Biochemistry 2020Quote: ... dmGemin2 was fused to a C-terminal Mxe intein (NEB) containing a hexahistidine tag ...
-
bioRxiv - Neuroscience 2022Quote: ... The chemical substrates were SNAP- tag ligands (SNAP surface 549 - BG 549 [NEB, S9112S]) and CLIP-tag ligands (CLIP surface 647 - BC 647 [NEB ...
-
bioRxiv - Cell Biology 2019Quote: ... and YQDA (D434W Y415A A463W Q433W) fused to a mCherry N-terminal tag were cloned using the NEBuilder HiFi DNA Assembly Cloning Kit (NEB #E5520) and introduced into pBlueScriptII with a VHA-6 promoter and tub terminator using the primers pvha6_fwd gacggtatcgataagcttgatatcggtatactatttattactcgatacttttg ...
-
bioRxiv - Biochemistry 2022Quote: ... The library was cloned into a pENTR1A plasmid backbone with a C-terminal YFP HA reporter tag using Gibson Assembly (HiFi DNA Assembly Cloning Kit, New England Biolabs, (NEB), Ipswich ...
-
bioRxiv - Cell Biology 2021Quote: ... were subcloned into phCMV3 to express C-terminal FLAG-tagged CatSper subunits (phCMV3-CatSperd or z-Flag) using NEBuilder® HiFi DNA Assembly Kit (NEB). A stop codon was placed at the upstream of HA-encoding sequences of phCMV3 vector for FLAG-tagged CatSper subunit cloning.
-
bioRxiv - Developmental Biology 2022Quote: Reporter gene fusions for cis-regulatory analysis of terminal identity genes were made using either PCR fusion (Hobert, 2002) or Gibson Assembly Cloning Kit (NEB #5510S). Targeted DNA fragments were fused (ligated ...
-
bioRxiv - Developmental Biology 2019Quote: Reporter gene fusions for cis-regulatory analysis of terminal identity genes were made using either PCR fusion [68] or Gibson Assembly Cloning Kit (NEB #5510S). Targeted DNA fragments were fused (ligated ...
-
bioRxiv - Cell Biology 2022Quote: ... An IFT144 construct lacking the N-terminal β-propeller domain (residues 2–349 inclusive; IFT144ΔNFLAG) was made using the Q5® Site-Directed Mutagenesis Kit (NEB).
-
bioRxiv - Neuroscience 2024Quote: ... C terminal and αPKC binding region) or PICK1 (BAR domain) were made with NEBuilder HiFi DNA Assembly Cloning Kit (NEB #E5520S). Mutations of PICK1 (KD-AA and 5K-E ...
-
bioRxiv - Biophysics 2023Quote: ... PUS1D134A lacking the N-terminal HIS-tag was subcloned into expression vector pET21d (EMD Biosciences) using a Gibson Assembly cloning kit and protocol (NEB # E5510S) and sequence verified ...
-
bioRxiv - Developmental Biology 2023Quote: ... This plasmid was modified to include a C-terminal V5 tag using Q5 Site-Directed Mutagenesis Kit (New England Biolabs, #E0554S). For arnt1-myc ...