Labshake search
Citations for New England Biolabs :
451 - 500 of 1435 citations for Anti Myc magnetic beads since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2022Quote: ... mRNA was purified with NEBNext Poly(A) Magnetic Isolation Module (New England Biolabs, Ipswich, MA) and heat fragmented with Elute-Prime-Fragment buffer (5x first-strand buffer ...
-
bioRxiv - Cell Biology 2023Quote: ... mRNAs were isolated using the NEBNext Poly(A) mRNA magnetic isolation module (New England Biolabs). RNAseq libraries were prepared for Illumina using the NEBNext Ultra-Directional RNA library preparation kit (New England Biolabs) ...
-
bioRxiv - Molecular Biology 2023Quote: ... mRNA was then extracted using a NEBNext Poly(A) mRNA Magnetic Isolation Module (NEB, E7490S) and RNA-seq libraries were prepared using a NEBNext Ultra Directional RNA Library Prep Kit for Illumina (NEB ...
-
bioRxiv - Cancer Biology 2023Quote: ... Library preparation was performed using the Poly(A) mRNA Magnetic Isolation Module (New England Biolabs) and the NEBNext Ultra II Directional RNA library Prep Kit for Illumina (New England Biolabs) ...
-
bioRxiv - Genetics 2023Quote: ... and mRNA was isolated using Poly(A) mRNA magnetic isolation module (New England BioLabs #E7490). The preparation of libraries followed the manufacturer’s protocol (Version 2.2 05/19) ...
-
bioRxiv - Cell Biology 2023Quote: ... and isolated using NEBNext Poly(A) mRNA magnetic isolation module (New England Biolabs, Cat. #E7490). HEK293 libraries were generated using NEBNext Ultra RNA Library Prep Kit for Illumina (New England Biolabs ...
-
bioRxiv - Bioengineering 2023Quote: ... NEBNext Poly(A) mRNA Magnetic Isolation Module (Catalog # E7490, NEW ENGLAND BIOLABS, MASSACHUSETTS, UNITED STATES), NEBNext Ultra II Directional RNA Library Prep Kit (Catalog # E7760 ...
-
bioRxiv - Zoology 2023Quote: ... Messenger RNA isolation was done with NEBNext Poly(A) Magnetic Isolation Modules (New England Biolabs) followed by the production of stranded cDNA libraries with NEBNext Ultra II Directional RNA Library Prep Kit for Illumina (New England Biolabs) ...
-
bioRxiv - Molecular Biology 2023Quote: ... PolyA+ selection was performed using an NEBNext Poly(A) mRNA Magnetic Isolation Module (NEB, #E7490) for total RNA from lines with Bon GLKD driven by nos-Gal4 (and matched siblings that lack the shRNA as control) ...
-
bioRxiv - Developmental Biology 2024Quote: ... mRNA was isolated using NEBNext Poly(A) mRNA Magnetic Isolation Module (E7490, New England Biolabs) following manufacturer’s instructions ...
-
bioRxiv - Microbiology 2023Quote: ... mRNA was then purified using NEBNext® Poly(A) mRNA Magnetic Isolation Module (NEB, E7490) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2023Quote: ... mRNA enrichment was done with the NEBNext Poly(A) mRNA magnetic isolation Module (NEB # E7490) (New England Biolabs (NEB) ...
-
bioRxiv - Genetics 2023Quote: ... in combination with the NEBNext Poly(A) mRNA Magnetic Isolation Module (New England BioLabs E7490L). Libraries were indexed with NEBNext Multiplex Oligos for Illumina (Dual Index Primers Set 1 ...
-
bioRxiv - Genetics 2023Quote: ... following manufacturer’s protocol for use with NEBNext Poly(A) mRNA Magnetic Isolation Module (NEB, #E7490). Libraries were checked for quality and average fragment size using ScreenTape analysis ...
-
bioRxiv - Neuroscience 2024Quote: ... Libraries were prepared using NEBNext Poly(A) mRNA Magnetic Isolation Module (New England Biolabs, #7490) and NEBNext Ultra II Directional RNA Library Prep Kit for Illumina (New England Biolabs ...
-
bioRxiv - Cell Biology 2024Quote: RNA-sequencing libraries were prepared NEBNext Poly(A) mRNA Magnetic Isolation Module kit (NEB Cat #) followed by NEBNext Ultra II Direction Prep Kit for Illumina (NEB Cat #) ...
-
bioRxiv - Cell Biology 2024Quote: ... mRNA was isolated using NEBNext Poly(A) mRNA Magnetic Isolation Module (New England BioLabs, #E7490). Poly(A ...
-
bioRxiv - Cancer Biology 2024Quote: ... Poly(A) RNA was isolated using the NEBNext Poly(A) mRNA Magnetic Isolation Module (NEB) and barcoded libraries were made using the NEBNext Ultra II Directional RNA Library Prep Kit for Illumina (NEB) ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... beads were directly used for off-bead PCR amplification using the Phusion High-Fidelity PCR kit (New England Biolabs) for 30 cycles with primers from library amplification (Rd1 ...
-
bioRxiv - Plant Biology 2021Quote: ... Immunoprecipitation experiments were performed with 15 μL of Pan anti-glycine lysine antibody conjugated to agarose beads (PTM Biolabs, Chicago, IL, USA) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2019Quote: ... where C-terminal Myc-DDK tag was replaced by HIS-V5 tag using a NEBuilder HiFi DNA assembly kit (New England Biolabs). SHIP2 deletion in 293T cells was carried out by CRISPR/Cas9 technology (Ran et al ...
-
bioRxiv - Cell Biology 2021Quote: ... Plasmids to express Flag-tagged and HA-tagged proteins were created by changing the Myc-coding sequence in pCMV-Myc expression plasmids to intended tag-coding sequence using inverse PCR and NE Builder HiFi Assembly (New England BioLabs), respectively.
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...
-
bioRxiv - Plant Biology 2021Quote: Blunt ended Myc tagged GUX and AtMAGT1 CDSs were amplified from a synthetic construct (synthesised by Genewiz) with Q5 DNA Polymerase (NEB) using primers detailed in Table S1 ...
-
bioRxiv - Molecular Biology 2019Quote: ... All the pCMV and pcDNA3.1-myc-eIF6 phospho-site mutants were generated using the Q5® Site-Directed Mutagenesis Kit (New England Biolabs) using the forward and reverse primers listed in Appendix Table S1 ...
-
bioRxiv - Microbiology 2022Quote: ... which was assembled with oligo DNA containing Myc or FLAG tag sequence using NEBuilder HiFi DNA Assembly Master Mix (New England Biolabs). The resultant plasmids were named pcDNA3-C-Myc or pcDNA3-C-FLAG ...
-
bioRxiv - Developmental Biology 2023Quote: ... MYC) were made in-house by in vitro transcription using mRNA synthesis with HiScribeTM T7 ARCA mRNA Kit (NEB E2060S) according to the manufacturer’s instructions ...
-
bioRxiv - Developmental Biology 2024Quote: ... Sox17 and sox32 deletion and domain switch constructs (Table S1) were generated using pCS2+sox17 and pCS2+myc-sox32 by PCR amplification using Q5 polymerase (NEB) using described primers (Table S2 ...
-
bioRxiv - Biochemistry 2023Quote: ... The pCR8[mZC3H18] plasmid was used as a template to generate subsequent ZC3H18 cDNA constructs that were cloned into a piggyBAC (pB) vector containing an N-terminal MYC tag and BSD selection marker using NEBbuilder HiFI DNA assembly (NEB). OsTIR1-HA ...
-
bioRxiv - Biochemistry 2020Quote: ... The DNA-bound beads were again washed twice in 2x Bead Wash Buffer and then washed twice in 1x Cutsmart Buffer (NEB) before being resuspended in 80 µL of 1x Cutsmart Buffer ...
-
bioRxiv - Cell Biology 2022Quote: ... A biotin pull down was then performed on the size-selected fragments using streptavidin-coated beads before library preparation on the beads using the standard NEBNext Ultra II DNA library prep kit for Illumina (NEB) protocol ...
-
bioRxiv - Bioengineering 2020Quote: A slurry of chitin beads (New England BioLabs) preequilibrated to and then suspended in 2 vol ...
-
bioRxiv - Genomics 2022Quote: ... RNA was purified using streptavidin beads (NEB, S1421S) and removed from beads using Trizol (Life Technologies ...
-
bioRxiv - Biochemistry 2019Quote: ... 7.5 μL of amylose beads (New England BioLabs), pre-blocked with 5% BSA ...
-
bioRxiv - Cancer Biology 2020Quote: ... and BSA (NEB #B9000S, 250 mg/mL beads) in dilution buffer (0.5% NP40 ...
-
bioRxiv - Cell Biology 2020Quote: ... Beads were resuspended in T4 ligation buffer (NEB) and 7.5 μM of primer pBB2 ...
-
bioRxiv - Molecular Biology 2021Quote: ... Eluted complexes were incubated with amylose beads (NEB) for 2h at 4°C ...
-
bioRxiv - Genomics 2022Quote: ... A first binding to streptavidin beads (NEB, S1421S) and washed as described (24) ...
-
bioRxiv - Cell Biology 2023Quote: ... 20-40 μl SNAP-Capture beads (NEB, S9145S) were pre-equilibrated in 150 mM NaCl ...
-
bioRxiv - Neuroscience 2023Quote: ... mRNA was enriched using poly-dT beads (NEB) and cleaned with Zymo clean and concentrator 5 according to standard protocol ...
-
bioRxiv - Microbiology 2023Quote: ... 0.15X (by volume) NEBNext Sample Purification Beads (NEB) were used for the first and second bead selection steps ...
-
bioRxiv - Genomics 2023Quote: ... combined with polyA-coupled beads (New England Biolabs) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: ... mRNA was captured using RNA purification beads (NEB). The eluted mRNA was fragmented and denatured for first and second strand synthesis for conversion into cDNA ...
-
bioRxiv - Microbiology 2024Quote: ... mRNA was enriched using oligo(dT) beads (NEB) and subsequently ...
-
ISL2 is an epigenetically silenced tumor suppressor and regulator of metabolism in pancreatic cancerbioRxiv - Molecular Biology 2020Quote: ... mRNA was isolated by using NEBNext Poly(A) mRNA Magnetic Isolation Module (New England Biolabs # 7490S). RNA-Seq libraries were prepared using the NEBNext Ultra Directional RNA Library Prep Kit for Illumina (New England Biolabs # E7420S ...
-
bioRxiv - Developmental Biology 2021Quote: ... mRNA pull-up was performed using the Magnetic Isolation Module (New England BioLabs, Catalog no. E7490). All 16 libraries were mixed at equal molarity in a single tube ...
-
bioRxiv - Genetics 2021Quote: ... with the PolyA selection with the NEBNext Poly(A) mRNA Magnetic Isolation Module (NEB, cat. # E7490). Agencourt AMPure XP beads (Beckman Coulter ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... Libraries were fragmented and enriched for mRNA using NEBNext Poly(A) Magnetic Isolation Module (NEB #E7490) and prepared using NEBNext Ultra II Directional RNA Library Prep Kit (NEB #E7765 ...
-
bioRxiv - Synthetic Biology 2021Quote: ... mRNA was purified using the NEBNext poly(A) mRNA Magnetic Isolation module (New England Biolabs, E7490) in accordance with the manufacturer’s protocol ...
-
bioRxiv - Plant Biology 2021Quote: ... mRNA enrichment was done using NEBNext Poly(A) mRNA Magnetic Isolation Module (New England Biolabs, USA), followed by heat fragmentation ...