Labshake search
Citations for Addgene :
451 - 500 of 552 citations for DNA Purification kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... Lentivirus was generated by co-transfection of HEK293T cells with destination vector plasmid DNA and the packaging plasmids pMDLg/pRRE (Addgene, 12251), pRSV-Rev ...
-
bioRxiv - Molecular Biology 2024Quote: ... Lentiviral constructs expressing TRMT1-WT or TRMT1-Q530N were generated by T5 Exonuclease DNA Assembly (TEDA) of PCR fragments into pLenti-CMV-GFP-Blast (Addgene 17445) (Xia et al ...
-
bioRxiv - Biophysics 2020Quote: ... we overexpressed lamin A by transiently transfecting the intact cells with m-Cherry tagged plasmid DNA for lamin A which was a gift from Michael Davison (Addgene, plasmid # 55068). To surpass lamin A expression ...
-
bioRxiv - Cell Biology 2020Quote: ... primary miRNAs for miR-29a and miR-16 were amplified from genomic DNA by PCR and cloned into the pAdTrack shuttle (Addgene, Plasmid#16404). The miR-16 pAdTrack plasmid was then mutated by site-directed mutagenesis to induce 3 point mutations into the miR-16 seed sequence ...
-
bioRxiv - Developmental Biology 2020Quote: The gRNA sequence for targeting p53 was cloned as double-stranded DNA oligonucleotides into the BbsI restriction site of the pX330-U6-Chimeric_BB-CBh-hSpCas9 vector (Addgene; Watertown, MA, USA) modified with a Puro-T2K-GFP cassette containing puromycin-resistance and eGFP expression by Dr ...
-
bioRxiv - Genetics 2019Quote: A DNA insert containing the ΔN-p73α coding DNA sequence (CDS) was then generated from a HA-p73α-pcDNA plasmid (a gift from William Kaelin; Addgene plasmid # 2210238) by PCR (Supplementary Table 1) ...
-
bioRxiv - Neuroscience 2020Quote: ... Viviana Gradinaru at the California Institute of Technology 90 and the DNA plasmid for AAV packaging is available from Addgene (plasmid#103005). Quality control of the packaged AAV was determined by viral titering to determine an adequate concentration was achieved (>5E12 viral genomes per mL) ...
-
bioRxiv - Bioengineering 2021Quote: ... 5 uL of serum-free media was added to 200 ng of plasmid DNA (100 ng CAG-nanobody-TagBFP plasmid and 100 ng CAG-dsRed plasmid (Addgene plasmid 11151) (Matsuda and Cepko ...
-
bioRxiv - Biochemistry 2021Quote: ... PLpro DNA was subcloned into the biGBac vector pLIB [29] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194). Baculoviruses were generated using the EMBacY baculoviral genome [30] in Sf9 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Neuroscience 2020Quote: ... and TVA DNA fragments were obtained from pAAV-phSyn1(S)-FLEX-tdTomato-T2A-SypEGFP-WPRE (a gift from Hongkui Zeng; Addgene plasmid #51509), pAAV-hSyn-DIO-hM4D(Gi)-mCherry (a gift from Bryan Roth ...
-
bioRxiv - Cell Biology 2021Quote: ... LifeAct mScarlet cell lines were generated by electroporating 2 μg/ml of pLifeAct-mScarlet-N1 plasmid DNA (a gift from Dorus Gadella, Addgene plasmid 85054) into WT and CD56-KO NK92 cells using the Amaxa nucleofector (Kit R ...
-
bioRxiv - Microbiology 2021Quote: ... 3 μg of the resulting covalently closed circular DNA was directly co-transfected with 330 ng of pHEF-VSV-G (Addgene Plasmid #22501) into 70% confluent monolayer of 293T cells in a 10 cm dish using polyethylenimine (Polysciences Inc ...
-
bioRxiv - Genomics 2021Quote: ... 100 ng of a synthetic gblock encoding the the HS-CRM8-TTRmin module38 upstream of dsRed (Integrated DNA Technologies) and 1 μg of sgOpti (gift from Eric Lander and David Sabatini, Addgene plasmid #85681)39 ...
-
bioRxiv - Biochemistry 2022Quote: ... and then shuttled as a mixture of DNAs into the pLenti CMV Puro DEST vector (gift from Eric Campeau and Paul Kaufman, Addgene plasmid # 17452) via an LR clonase II reaction (Invitrogen ...
-
bioRxiv - Microbiology 2022Quote: ... full length 3CLpro coding-sequences with N-terminal 6His tags were synthesized by Integrated DNA Technologies (Coralville, IA) and cloned into pET-28a(+) vector (Addgene, Cambridge, MA). Subsequently ...
-
bioRxiv - Immunology 2020Quote: ... the lentiCas9-v2 lentivirus were produced from HEK-293FT cells transfected with the lentiCas9-v2 plasmid mixed at a 2:1:1 DNA ratio of the lentiviral packaging plasmids pMD2.G (Addgene plasmid #12259) and psPAX2 (Addgene plasmid #12260 ...
-
bioRxiv - Cancer Biology 2022Quote: ... A solution of retroviral DNA plasmids (TRI-dsRED-IDH1R132H, MSCV-GFP-DNMT3AR882H, MSCV-tTA-NrasG12D, pclEco packaging vector (Addgene plasmid cat# 12371), 0.25 M CaCl2 ...
-
bioRxiv - Neuroscience 2022Quote: ... Viviana Gradinaru at the California Institute of Technology (Chan et al., 2017) and the DNA plasmid for AAV packaging is available from Addgene (plasmid#103005). Quality control of the packaged AAV was determined by qPCR to determine viral titer (viral genomes/mL) ...
-
bioRxiv - Genomics 2019Quote: ... were seeded in a 12-well plate and cultured for 24 h before transfection with Sp1-luciferase reporter plasmid DNA (0.5 g; Panomics, Fremont, CA, USA) or a 3× ERE TATA luc construct (Addgene, Cambridge, MA, USA) for 24 h ...
-
bioRxiv - Cell Biology 2020Quote: ... Homology directed repair donor plasmids were generated using a combination of gene synthesized DNA sequences for ∼ 225 bp homology arms and either mAID-mCherry2 derived from plasmids pMK292 (Addgene plasmid 72830) for C-terminal tagging ...
-
bioRxiv - Molecular Biology 2020Quote: Stable knock out cell lines were generated by small guide RNA (sgRNA) mediated Cas9 DNA cleavage using the pX330 plasmid (Cong et al., 2013; Hsu et al., 2013, Addgene plasmid #42230). DNA oligonucleotides were hybridized and ligated into the BbsI digested pX330 to introduce the sgRNA sequence into the vector ...
-
bioRxiv - Cell Biology 2021Quote: ... gRNAs were ordered as complementary single-stranded oligonucleotides from Integrated DNA Technologies (IDT) then cloned into the px459 plasmid (Addgene plasmid #62988) using a one-step ligation protocol (Ran et al. ...
-
bioRxiv - Cell Biology 2021Quote: The pFHL-plasmid for dual expression was constructed using four DNA fragments: (i) the Kanamycin resistance gene and ColE1 origen of replication from a C1 plasmid (Addgene plasmid #54842), followed by (ii ...
-
bioRxiv - Biochemistry 2021Quote: DNA encoding human RTCB (Uniprot Q9Y3I0) was inserted using ligation-independent cloning into the UC Berkeley MacroLab 438B vector (Addgene plasmid #55219) and DDX1 (Uniprot Q92499) ...
-
bioRxiv - Biochemistry 2021Quote: DNA encoding amino acids Phe2-Asp101 of human CGI-99 was cloned into the UC Berkeley MacroLab 1B vector (Addgene plasmid # 29653). The fusion protein containing an N-terminal His6 tag and a TEV protease cleavage site was expressed in BL21 (DE3 ...
-
bioRxiv - Developmental Biology 2022Quote: ... were cloned as double-stranded oligo DNA into BbsI and SapI sites in pX330-U6-Chimeric_BB-CBh-hSpCas9 vector (Addgene; Watertown, MA, USA) modified with a Puro-T2K-GFP cassette containing puromycin-resistance by Dr ...
-
bioRxiv - Cancer Biology 2022Quote: ... Luciferase-expressing EMT6 cells were generated by transfecting the parental line with a plasmid DNA encoding a CMV promoter-driven firefly luciferase (Luciferase-pcDNA, prepared in X420 as pcDNA3_CMV-Fluc; Addgene®, cat.# 18964) using Polyplus® JetPrime™ as per the manufacturer’s protocol ...
-
bioRxiv - Developmental Biology 2023Quote: Riboprobes for in situ hybridization were synthesized using the oligonucleotide primers listed in Supplementary Table 4 to clone the DNA fragment of interest into vector pJC53.2 (Addgene Plasmid ID: 26536), followed by riboprobe synthesis previously described 80.
-
bioRxiv - Cancer Biology 2023Quote: ... self-complementary single-stranded DNA oligos (Supp Table S2) were annealed and cloned into AgeI/EcoR1 sites of Tet-pLKO-puro vector (Addgene plasmid # 21915). All constructs were validated by direct sequencing ...
-
bioRxiv - Cell Biology 2023Quote: ... The hybridized double-stranded (ghCOL7A1-S + ghCOL7A1-A) DNA fragment cloned into the Esp3I (BsmBI) restriction sites of the LentiCRISPRv2GFP (Addgene plasmid # 82416) using a simultaneous digestion-ligation reaction as described previously (16) ...
-
bioRxiv - Biochemistry 2022Quote: ... The following plasmids used for DNA damage experiments in HeLa Tet-On cells were gifts from Kathleen Burns33: pDA007 (Addgene plasmid # 131380), pDA025 (Addgene plasmid # 131384) ...
-
bioRxiv - Cell Biology 2023Quote: ... self-complementary single-stranded DNA oligos (Supp Table S1) were annealed and cloned into AgeI/EcoR1 sites of Tet-pLKO-puro vector (Addgene plasmid # 21915). MSI2 ORF (NM_138962.2 ...
-
bioRxiv - Biochemistry 2023Quote: ... fluorophore labelled ‘601’ DNA was generated using large-scale PCR with Phusion polymerase (produced in-house) from a pGEM- 3z/601 plasmid containing one copy of ‘601’ DNA (gift from J. Widom, Addgene plasmid #26656)(Lowary & Widom ...
-
bioRxiv - Developmental Biology 2023Quote: Upstream cis-regulatory elements were amplified from wildtype zebrafish genomic DNA and cloned into the e1b-eGFP-Tol2 vector (available from Addgene, Plasmid #37845) by restriction cloning at the XhoI and BglII sites ...
-
bioRxiv - Developmental Biology 2024Quote: DNA templates for CRISPR gRNAs were synthesized using plasmid pX335-U6- Chimeric_BB-CBh-hSpCas9n(D10A) (Addgene, plasmid #42335; Cong et al., 2013) containing the gRNA scaffold ...
-
bioRxiv - Molecular Biology 2020Quote: ... The EMMA toolkit was a gift from Yizhi Cai (Addgene kit # 1000000119) [25] ...
-
bioRxiv - Neuroscience 2019Quote: ... using the Golden Gate TALEN and TAL Effector Kit 2.0 (Addgene 1000000024). TALEN mRNAs were synthesized by in vitro transcription using the mMessage mMachine SP6 Kit (Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2022Quote: ... The EMMA toolkit was a gift from Yizhi Cai (Addgene kit # 1000000119). Various parts from the toolkit were used for construction of the vectors ...
-
bioRxiv - Molecular Biology 2023Quote: ... David Virshup and Xi He from the plasmid kit73 (Addgene kit # 1000000022). HALO*EBP-HA and HALO*EBP constructs were originated from a pBSM13-Pax7HALO plasmid that was designed in our lab ...
-
bioRxiv - Molecular Biology 2023Quote: ... Yeast Toolkit plasmids were a gift from John Dueber (Addgene kit # 1000000061). pAJ4619 was made from pAJ4618 by inverse PCR using oligos AJO3551 and AJO3539 ...
-
bioRxiv - Neuroscience 2020Quote: ... Oligonucleotides encoding guide sequences are purchased from Integrated DNA Technologies (IDT) and cloned individually into BbsI fragment of pX458 (Addgene plasmid 48138(54)) ...
-
bioRxiv - Plant Biology 2022Quote: ... while the full-length coding sequence of HlMYB7 was cloned into the prey vector pGADT7-GW [DNA-binding domain (BD)] (Addgene Inc, MA, USA) using the In-Fusion Snap Assembly Kit (Takara Bio) ...
-
bioRxiv - Neuroscience 2024Quote: Vectors coding the dCas9-DNMT3ACD-DNMT3LCD-3xFLAG fusion gene (contains the enzymatic group of the DNA methyltransferase DNMT3) and the control plasmid pCMV-dCas9-mD3A (#78257, Addgene, Watertown, MA, USA) were used as described in 14,22 ...
-
bioRxiv - Systems Biology 2021Quote: ... individual drivers were PCR amplified out of the Cancer Pathways kit (Addgene #1000000072)21 ...
-
bioRxiv - Biochemistry 2021Quote: ... The RAS clone collection was a gift from Dominic Esposito (Addgene kit 1000000070). GST tagged RAF1-RBD (GST-RAF-RBD ...
-
bioRxiv - Synthetic Biology 2023Quote: ... we performed two-step cloning using a Platinum Gate TALEN kit (Addgene, #1000000043). In the assembly-step 1 ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... The ENO1 terminator fragment was amplified from pYTK051 (Addgene Kit #1000000061 position E3) (Lee et al ...
-
bioRxiv - Genetics 2022Quote: ... The resulting modified LexA (mLexA) chimeras were combined through DNA assembly (Gibson et al. 2009) with the following components: eLOV (Addgene # 92213, Alice Ting lab) (Wang et al ...
-
bioRxiv - Cancer Biology 2020Quote: ... KIT D816V ESCs were generated as described previously using the pX335 vector (Addgene 42335) and oligonucleotides listed in supplemental Table 3.29
-
bioRxiv - Cancer Biology 2022Quote: ... Luciferase/tdTomatao reporter was engineered using the MuLE system kit from Addgene (Cat. # 1000000060) (54).