Labshake search
Citations for GenScript :
401 - 450 of 688 citations for 2H Pyrazolo 4 3 c pyridine 3 chloro 4 5 6 7 tetrahydro since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2024Quote: ... 5 μg of DBR1 expression vector (GenScript, OHu11162) was transfected into cells using Lipofectamine 3000 (Invitrogen ...
-
bioRxiv - Molecular Biology 2021Quote: ... the C-terminal fragment of the CLEC16A disease isoform (OHu02258D; Genscript) was liberated by BamHI restriction digest ...
-
bioRxiv - Neuroscience 2020Quote: ... Plasmids expressing C-terminally Flag-tagged Cav2.3 were obtained from GenScript. Cultured human embryonic kidney 293 (HEK293 ...
-
bioRxiv - Biochemistry 2020Quote: ... 1+/c-(k) - dyk expression vector for mammalian cells by GenScript Corporation (Piscataway ...
-
bioRxiv - Immunology 2020Quote: pcDNA3.1+/C-(K)DYK-slamf6 transcript isoforms were purchased from Genscript (OHu04772 ...
-
bioRxiv - Neuroscience 2022Quote: ... or pLenti-TDP-43ΔNLS/2KQL-C-mGFP (Origene, mutations by GenScript). Cells were seeded onto coverslips in 24-well plates at a density of 25,000 cells/well and incubated for 24 h ...
-
bioRxiv - Biophysics 2023Quote: A Gly-Gly-Gly-Cys peptide with C-terminal amidation (Genscript) was dissolved at 173 mM in degassed coupling buffer (50 mM HEPES (pH 7.4) ...
-
bioRxiv - Biochemistry 2023Quote: ... human ARL15 (NM_019087.3) in the pcDNA3.1+/C-(K)-DYK vector (GenScript) was used and further employed to introduce the mutations into the construct ...
-
bioRxiv - Cancer Biology 2024Quote: ... pcDNA3.1+/C-(K)-DYK-AT20 (pATP5⍺-AT20) were generated by GenScript Inc ...
-
bioRxiv - Biochemistry 2023Quote: Five constructs (P2-6, Figure 1) were synthesised and cloned in to the pFastBAC1 vector by Genscript. The Mellitin signal sequence to direct secretion of the expressed protein (26 ...
-
bioRxiv - Immunology 2021Quote: ... To monitor V2 responses cyclized C.1086 V2 (cV2, synthesized by GenScript) 157CSFNATTELKDKKHKVHALFYKLDVVPLNGNSSSSGEYRLINC196 was used at 1μg/ml in PBS for coating ...
-
bioRxiv - Biochemistry 2021Quote: ... and pcDNA 3.1+/C-(K)-DYK empty vector were obtained from GenScript Biotech (GenScript ...
-
bioRxiv - Molecular Biology 2020Quote: ... The pCCL-WSB1 and pCCL-c-Myc plasmids were purchased from Genscript, and were re-constructed to pCDH vector with N-terminal FLAG tag ...
-
bioRxiv - Microbiology 2022Quote: ... and pangolin) with a C-terminal V5 tag were synthesized by GenScript as described previously 42 ...
-
bioRxiv - Microbiology 2024Quote: ... RBP-coding DNA was cloned into a pcDNA3.1-C-HisTag vector (Genscript). For paramyxoviruses ...
-
bioRxiv - Microbiology 2024Quote: ... were removed using C-terminal truncations or internal deletions conducted by GenScript. For in vitro biochemical characterization ...
-
bioRxiv - Bioengineering 2021Quote: ... and 5 mM RGD peptide (Ac-RGDSPGERCG-NH2, Genscript) in PBS at a rates of 0.5 - 5 µL/min ...
-
bioRxiv - Cell Biology 2024Quote: ... The supernatant was mixed with 5× sample buffer (GenScript), heated to 100°C for 10 min ...
-
bioRxiv - Neuroscience 2024Quote: ... we made a TAT peptide with aspartate substitutions in critical residues (M113D and W116D) within the 7-residue oligomerization motif (GenScript Biotech Corporation, Piscataway, NJ) (Figure 6A) ...
-
bioRxiv - Molecular Biology 2022Quote: ... Sepharose beads were then eluted with 0.5 mg/ml c-Myc peptide (Genscript) in TBS ...
-
bioRxiv - Neuroscience 2021Quote: TMEM106B C-terminal fragment (120 – 274) incorporated in pET3A was purchased from Genscript™ ...
-
bioRxiv - Biochemistry 2021Quote: LD membrane protein cDNAs in pcDNA3.1+/C-(k)DYK were purchased from GenScript and their variants with the OPG2 tag ...
-
bioRxiv - Biochemistry 2024Quote: ... hAPN with a C-terminal Flag tag was cloned into pcDNA3.1+ by GenScript. HEK293T cells seeded at 16E6 cells in 100 mm dishes coated with poly-D-Lysine and incubated overnight at 37 °C with 5% CO2 ...
-
bioRxiv - Biophysics 2024Quote: The mPRD2 construct with a C-terminal His-tag was bought from Genscript Inc ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... all with a C-terminus FLAG tag epitope (all from Genscript, Piscataway, NJ). Transfections were performed using Lipofectamine 2000 (ThermoFisher Scientific ...
-
bioRxiv - Biophysics 2024Quote: Purification of recombinant mouse cMyBP-C was accomplished using plasmids obtained from GenScript© and VectorBuilder© that were codon optimized for expression in bacteria ...
-
bioRxiv - Immunology 2022Quote: ... Omicron BA.1 and BA.5 was performed by GenScript, Nanjing ...
-
bioRxiv - Bioengineering 2022Quote: ... The rat Arc 5’ UTR sequence was synthesized by Genscript. Molecular cloning techniques (PCR amplification ...
-
bioRxiv - Biochemistry 2024Quote: hOrc1-5 expression plasmids were generated by gene synthesis (Genscript) based on pESC vectors (Stratagene ...
-
bioRxiv - Microbiology 2024Quote: ... A high purity Hst-5 peptide was synthesized by GenScript and Hst-5 specific rabbit polyclonal antibody was produced by Lampire Biological Laboratories ...
-
bioRxiv - Immunology 2022Quote: ... 6 and 8 were analyzed with the cPass™ SARS-CoV- 2 neutralization antibody detection kit (GenScript, Cat #L00847) to detect any antibodies that neutralize the interaction between the RBDdelta and the ACE2 receptor ...
-
bioRxiv - Biochemistry 2024Quote: Synthetic genes with N-terminal histidine tag (either 6-His or 10-His for ROCKETAAXWA) were synthesized by Genscript Inc or derived from mutagenesis in a pet26b (+ ...
-
bioRxiv - Biochemistry 2020Quote: ... faecalis (UniProtKB-Q07448) and with a C-terminal His6-tag were synthesized by GenScript and cloned into the the pET11a vector ...
-
bioRxiv - Bioengineering 2021Quote: ... pcDNA3.1+C-eGFP plasmid and plasmid encoding Cas9 and sgRNA were purchased from GenScript® ...
-
bioRxiv - Molecular Biology 2022Quote: ... Sam68 C-terminal cDNA was synthetized with optimized codon composition for bacterial expression (Genscript).
-
bioRxiv - Developmental Biology 2020Quote: ... Full-length mRNA constructs in pcDNA3.1+/C-(K)DYK vectors were obtained from GenScript Biotech (Piscataway ...
-
bioRxiv - Microbiology 2023Quote: ... Full-length and C-terminal constructs were purified by Ni-IDA affinity chromatography (GenScript) as per the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2023Quote: Synthetic peptides of P covering the sequence N-EDDIYQLIM-C were obtained from GenScript. The peptide was dissolved in deionised water dosed with a drop of 5 M NH4OH to improve solubility ...
-
bioRxiv - Molecular Biology 2023Quote: ... pcDNA3.1-C-FLAG containing human ATP6V1H transcript variant 1 (NM_015941.4) was purchased commercially (GenScript). pcDNA3.1-ATP6V1H(1-351)-FLAG ...
-
bioRxiv - Cancer Biology 2024Quote: ... oeANXA4: Human ANXA4 (NM_001320698.2) in pcDNA3.1+/C-(K)-DYK vector was purchased from GenScript (GenScript Biotech ...
-
bioRxiv - Cancer Biology 2021Quote: ... The custom polyclonal p-Smurf2Thr249 antibody was generated (#J1683BA260-5) (GenScript). Briefly ...
-
bioRxiv - Cell Biology 2021Quote: ... All AtLEA4-5 Scrambled ORFs were synthesized as gene fragments (Genscript).
-
bioRxiv - Evolutionary Biology 2022Quote: Protein G (5 μg/ml, 50 μl/well; Genscript, China, Z02007) was diluted to 5 μg/ml with PBS (0.01 M ...
-
bioRxiv - Immunology 2022Quote: ... 5 μl synthetic antigen peptide (Genscript, 0.2 mg/ml in PBS), or 5 μl heat-killed bacteria in PBS ...
-
Tail Length and E525K Dilated Cardiomyopathy Mutant Alter Human β-Cardiac Myosin Super-Relaxed StatebioRxiv - Molecular Biology 2023Quote: For experiments where 2’-deoxyadenosine-5’-triphosphate (dATP) (GenScript, Piscataway, NJ) was used to limit the myosin SRX state29 ...
-
bioRxiv - Molecular Biology 2020Quote: Codon optimized Gcn5 (S. pombe) with 1 × FLAG was cloned into pET28a in frame with N terminal 6 × HIS tag by GenScript to generate JP-2587.
-
bioRxiv - Plant Biology 2020Quote: ... coli codon-optimized gene for Arabidopsis UVR8 was introduced into the pET11a expression vector generating a construct carrying an N-terminal 6×His-tag (Genscript). The construct was verified by DNA-sequencing and transformed into the E ...
-
bioRxiv - Biophysics 2021Quote: ... Both ghrelin receptor–Gq complexes were formed on the membrane in the presence of 10 μM ligands (ghrelin or GHRP-6, synthesized by GenScript) and treated with apyrase (25 mU/ml ...
-
bioRxiv - Biochemistry 2021Quote: ... Cells were plated in a 6 well plate and co-transfected with 1 μg of pUC57-NASP-FKBP12F36V (by Genscript) and 2 μg of pSpCas9(BB)-2A-Puro-NASP-sgRNA_V2.0 (#62988 ...
-
bioRxiv - Biochemistry 2023Quote: ... T4-foldon trimerisation domain and ADAH11 spaced by glycine-serine linker sequences (Supplementary Table 6) was inserted into the pHEN6 plasmid (Genscript), expressed in T7 Express E ...