Labshake search
Citations for GenScript :
351 - 400 of 803 citations for Recombinant Human CD3E & CD3D His & Flag tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... 4) TCRβ-CD3δ crosslinking: mouse anti-V5 and rabbit anti-FLAG (Genscript); 5 ...
-
bioRxiv - Immunology 2022Quote: ... 2) TCRα-CD3δ crosslinking: rabbit anti-cMyc and mouse anti-FLAG (Genscript); 3 ...
-
bioRxiv - Cell Biology 2019Quote: ... Flag-tagged TRMT6 and TRMT61A mammalian expression vectors were purchased from Genscript. Two additional Flag tags where inserted into the vector coding TRMT61A ...
-
bioRxiv - Microbiology 2019Quote: ... discoideum crude extract with an anti-FLAG rabbit polyclonal antibody (GenScript, USA). For ectopic expression assays ...
-
bioRxiv - Cell Biology 2020Quote: ... Bound protein was eluted using an excess of FLAG peptide (Genscript, China). The eluate was concentrated using Sartorius spin columns with a cutoff of 30kDa (Sartorius) ...
-
bioRxiv - Biophysics 2020Quote: ... and the protease inhibitor cocktail plus 200 μg/ml FLAG peptide (GenScript). The eluent was then concentrated using a 50-kDa cut-off Centricon (Millipore ...
-
bioRxiv - Microbiology 2021Quote: ... the FLAG-tagged Vigilin cDNA was purchased from Genscript (Clone ID: OHu17734) and the Myc-tagged SERBP1 cDNA was purchased from Genscript (Clone ID ...
-
bioRxiv - Cancer Biology 2023Quote: ... mENPP1-WT sequence was amplified from pcDNA3-mENPP1-FLAG (synthesized by Genscript) using pLenti_mENPP1_fwd and pLenti_mENPP1_rev primers in Table S1 and inserted into the XbaI-BamHI sites of pLenti-CMV-GFP-Puro (Addgene) ...
-
bioRxiv - Molecular Biology 2023Quote: The following commercial antibodies were used: FLAG (A00187, GenScript, mouse, 1:1000); HA (11867423001 ...
-
bioRxiv - Biochemistry 2022Quote: ... DARPins were detected with rabbit anti-FLAG antibody (GenScript, A01868; 1:5,000) and goat anti-rabbit-AP antibody (Sigma-Aldrich ...
-
bioRxiv - Immunology 2023Quote: Mammalian expression vectors employed in this study include pcDNA3.1-ELKS-Flag (Genscript), pcDNA3.1-IKKε-Flag (OHu2671 ...
-
bioRxiv - Biochemistry 2024Quote: ... and supernatant was applied to incubate with anti-Flag affinity resin (Genscript) at 4 °C for 1.5 hours ...
-
bioRxiv - Cell Biology 2019Quote: ... Rat polyclonal antibodies against full-length recombinant GST-tagged PfAlba3 were from GenScript Corporation ...
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant BRD4 N-terminal protein was purchased from GenScript (BRD4-N (49-460aa), His ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Some recombinants were generated by homologous recombination using GenBuilder Kit (GenScript Biotech Corporation) following manufacturer’s instructions.
-
bioRxiv - Biophysics 2021Quote: ... This was followed by several PBS wash steps and incubation with anti-His antibody (#25B6E11, Genscript) at a dilution of 1:500 for 1h in 0.1 % FBS/PBS ...
-
bioRxiv - Biophysics 2019Quote: ... His-tagged Xenopus laevis HAUS8 was used to produce rabbit polyclonal anti-HAUS8 anti-serum (Genscript). Alexa-647 labelled XenC antibody was generated by first dialyzing antibodies in PBS buffer (50mM NaPO4 ...
-
bioRxiv - Biophysics 2019Quote: ... anti-sera were generated against His-tagged HAUS1 and C-terminal fragment HAUS6 as well (Genscript). All custom-made antibodies were purified from serum with an antigen-coupled matrix (Affi-Gel 10 or 15 ...
-
bioRxiv - Molecular Biology 2021Quote: AngII and TRV023 (Sar-Arg-Val-Tyr-Lys-His-Pro-Ala-OH) were synthesized by GenScript USA (Piscataway ...
-
bioRxiv - Biochemistry 2020Quote: ... archaeon HeR gene (GenBank ID: KYK26602.1) containing an N-terminal histidine-tag was chemically synthesized (GenScript) and subcloned into the pET21a (+)-vector ...
-
bioRxiv - Biophysics 2020Quote: ... Lentiviral vector pAIP-NSP2-SNAP was generated using a synthetic SNAP tag-coding DNA (GenPart, Genscript) inserted into a double digested with MluI/EcoRI pAIP-NSP2-mCherry vector16 ...
-
bioRxiv - Immunology 2019Quote: 96-well plates were coated overnight at 4°C with mouse anti-Avi-tag antibody (Genscript) at 2 μg/ml in PBS ...
-
bioRxiv - Cell Biology 2022Quote: ... transferred to nitrocellulose membrane and the protein tags were detected by rabbit anti-BAP antibody (Genscript) and rat anti-HA antibody (Roche) ...
-
bioRxiv - Cell Biology 2023Quote: ... The N-terminal 3xFlag tag was removed by incubation with the GST tagged Prescission Protease (GenScript) (final 0.01U/ul ...
-
bioRxiv - Biochemistry 2023Quote: ... wild-type OGG1 was expressed with a GST tag from a pGEX-6P1clone purchased from GenScript. The plasmid was transformed into T7 Express plysS Competent E ...
-
bioRxiv - Synthetic Biology 2023Quote: ... diluted to OD of 0.1 – 0.3 and stained with THETM iFluor 647 HA Tag antibody (GenScript; 1:500 – 1:1,000 dilution of 0.5 mg/ml stock in 10 mg/ml BSA ...
-
bioRxiv - Biochemistry 2021Quote: ... the supernatant was collected and applied to anti-Flag G1 affinity resin (GenScript). The resin was rinsed with wash buffer (W1 buffer ...
-
bioRxiv - Cancer Biology 2022Quote: ... and c-Flag ERβ (OHu25562D; pcDNA3.1+/C-(K) DYK were obtained from GenScript.
-
bioRxiv - Biophysics 2021Quote: ... Purified EGF-like domain of NRG1β was incubated with G1 Flag Resin (Genscript) for 1 hr at 4 °C and serially washed 3x with Buffer A (50 mM Tris-HCl pH 7.4 ...
-
bioRxiv - Cell Biology 2021Quote: ... Lysate was flowed over an Anti-FLAG resin (GenScript, Piscataway, NJ, US, L00432) column at 1 mL/min ...
-
bioRxiv - Molecular Biology 2020Quote: ... The first round of selection was performed with anti-FLAG affinity resin (GenScript) and captured complexes were eluted with 3xFLAG-peptide (ApexBio) ...
-
bioRxiv - Cell Biology 2023Quote: Humanized DmMIC10b-FLAG flanked by AgeI and EcoRV restriction sites (obtained from GenScript) was inserted into the AgeI/EcoRV restriction sites of AAVS1-TRE3G-Mic10-FLAG-T2A-EGFP (T ...
-
bioRxiv - Molecular Biology 2023Quote: ... The bound proteins were eluted with Flag peptide (200 μg/ml; GenScript, RP10586) in thermomixer at 4 °C ...
-
bioRxiv - Biochemistry 2023Quote: ... and the supernatant was incubated with anti-Flag affinity resin (GenScript Co., Ltd.) at 4 °C for 90 minutes ...
-
bioRxiv - Genetics 2024Quote: ... HRP-conjugated mouse monoclonal antibody against FLAG was obtained from GenScript (Cat# A01428).
-
bioRxiv - Microbiology 2023Quote: The full recombinant MPL36 protein (rMPL36/aa 41-321) was commercially produced by GenScript® Biotech with His-tag in an E ...
-
bioRxiv - Cell Biology 2023Quote: The pcDNA3.1-NR2A (catalog #: OHu24642D, NM_000833, human) and the pcDNA3.1-NR1 (catalog #: OHu22255D, NM_007327, human) plasmids were purchased from GenScript. The pcDNA3.1-BiP plasmid was provided by Dr ...
-
bioRxiv - Immunology 2019Quote: 96-well ELISA plates were coated overnight at 4°C with mouse anti-Avi-tag antibody (Genscript) at 2 μg/ml in PBS ...
-
bioRxiv - Cell Biology 2023Quote: ... an SBP tag and the mRFP coding sequence was synthesized and cloned into pUC57-KanR (GenScript Inc.) and subcloned as an EcoRI-XBaI fragment into pUASTattB (Bischof et al. ...
-
bioRxiv - Physiology 2024Quote: ... Human HSD17B13 (NCBI Accession number: NM_178135.5) with HA-tag on the C-terminus was cloned into pcDNA3.1 (Genscript). HEK293 cells and HepG2 cells were transfected with HSD17B13 or empty control vector using Lipofectamine 2000 ...
-
bioRxiv - Bioengineering 2021Quote: ... 2 mM CaCl2) using 10 U of Recombinant Bovine His6-Enterokinase (GenScript, Piscataway, NJ, USA) overnight at room temperature ...
-
bioRxiv - Biochemistry 2022Quote: cDNA constructs for expression of recombinant Mac-1 in mammalian cells were generated by GenScript. ITGAM cDNA was cloned into the vector pcDNA3.1/HygroB(+) ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Microbiology 2023Quote: ... enterica Tsr LBD construct for recombinant protein expression was performed as a service by Genscript Biotech Corp ...
-
bioRxiv - Biophysics 2019Quote: ... FLAG-tagged hZP3 and HA-tagged hZP4 were synthesized (GenScript; GeneArt/Thermo Fisher Scientific) and subcloned into pHLsec329 ...
-
bioRxiv - Immunology 2021Quote: ... Enriched B cells were stained with Flag tagged SARS-CoV-2 spike (Genscript, Z03481) then incubated with APC conjugated anti-Flag and PE conjugated anti-Flag for double staining ...
-
bioRxiv - Neuroscience 2022Quote: ... FLAG-tagged wildtype CDK6 and CDK6pA197T cDNA was cloned into in pcDNA3.1 by GenScript.
-
bioRxiv - Cell Biology 2019Quote: Flag-tagged TRMT6 and TRMT61A mammalian expression vectors were purchased from Genscript (Piscataway, NJ). Two additional Flag tags where inserted into the vector coding TRMT61A ...
-
bioRxiv - Cell Biology 2021Quote: ... Anti-FLAG agarose beads and streptavidin-affinity magnetic beads were from Genscript (Nanjing, Jiangsu); Protein A/G magnetic beads were from Thermo Fisher Scientific.
-
bioRxiv - Biophysics 2022Quote: ... The clarified lysate was then incubated with 125 µL of G1 Flag resin (Genscript) per 30 ml culture overnight at 4 °C with rotating before washing with 50 bead volumes of lysis buffer ...