Labshake search
Citations for GenScript :
301 - 350 of 1128 citations for Recombinant Human PPAR gamma Protein His tag since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: ... human AMPKγ3 (GenScript, NJ, USA) and mouse AMPKγ3 (Yenzym ...
-
bioRxiv - Systems Biology 2024Quote: Human SHROOM3 mutant constructs (GenScript) with deletions of PDZ ...
-
bioRxiv - Biochemistry 2021Quote: ... The C-terminal TwinStrep-HA tag (sequence TGGGGSGGGASWSHPQFEKGGSGGGSWSH PQFEKGGYPYDVPDYA*) was synthetized and cloned (by Genscript) between the EcoRI and BamHI sites of the pLVX-TetOne-Puro vector (631849 ...
-
bioRxiv - Immunology 2024Quote: All constructs contained a C-terminal histidine affinity tag and were codon optimized by GenScript for mammalian cell expression ...
-
bioRxiv - Biochemistry 2024Quote: ... terminator and tag parts were obtained either as ampicillin-resistant plasmids from gene synthesis (GenScript), gene fragments (IDT gBlocks) ...
-
bioRxiv - Biophysics 2021Quote: ... This was followed by several PBS wash steps and incubation with anti-His antibody (#25B6E11, Genscript) at a dilution of 1:500 for 1h in 0.1 % FBS/PBS ...
-
bioRxiv - Molecular Biology 2021Quote: AngII and TRV023 (Sar-Arg-Val-Tyr-Lys-His-Pro-Ala-OH) were synthesized by GenScript USA (Piscataway ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Some recombinants were generated by homologous recombination using GenBuilder Kit (GenScript Biotech Corporation) following manufacturer’s instructions.
-
bioRxiv - Biophysics 2024Quote: Purification of recombinant mouse cMyBP-C was accomplished using plasmids obtained from GenScript© and VectorBuilder© that were codon optimized for expression in bacteria ...
-
bioRxiv - Cell Biology 2020Quote: Sequences of full length hsRIPK2 with an N-terminal 3x-Flag tag were synthesized by Genscript and cloned into doxycycline-inducible lentiviral expression vectors (pF_TRE3G_rtTAAd_puro (Takara Bio)) ...
-
bioRxiv - Biochemistry 2020Quote: ... archaeon HeR gene (GenBank ID: KYK26602.1) containing an N-terminal histidine-tag was chemically synthesized (GenScript) and subcloned into the pET21a (+)-vector ...
-
bioRxiv - Biophysics 2020Quote: ... Lentiviral vector pAIP-NSP2-SNAP was generated using a synthetic SNAP tag-coding DNA (GenPart, Genscript) inserted into a double digested with MluI/EcoRI pAIP-NSP2-mCherry vector16 ...
-
bioRxiv - Cell Biology 2023Quote: ... The N-terminal 3xFlag tag was removed by incubation with the GST tagged Prescission Protease (GenScript) (final 0.01U/ul ...
-
bioRxiv - Biochemistry 2023Quote: ... wild-type OGG1 was expressed with a GST tag from a pGEX-6P1clone purchased from GenScript. The plasmid was transformed into T7 Express plysS Competent E ...
-
bioRxiv - Synthetic Biology 2023Quote: ... diluted to OD of 0.1 – 0.3 and stained with THETM iFluor 647 HA Tag antibody (GenScript; 1:500 – 1:1,000 dilution of 0.5 mg/ml stock in 10 mg/ml BSA ...
-
bioRxiv - Plant Biology 2024Quote: ... the membrane was incubated in the same solution with RFP-tag primary antibody (GenScript, ref. A00682) at a 1/200 dilution for 1h at room temperature ...
-
bioRxiv - Microbiology 2024Quote: Human codon-optimized cDNA (Genscript, USA) encoding the NA ectodomains of A/Wisconsin/09/2013 (H1N1 ...
-
bioRxiv - Microbiology 2024Quote: ... Human codon-optimized cDNA (Genscript, USA) encoding these regions was cloned into pCAGGS expression plasmids containing the human IgG1 heavy chain and Ig kappa light chain constant regions.55 Recombinant hIgG1 12F5 ...
-
bioRxiv - Biochemistry 2024Quote: Human mAC genes were from GenScript and fitted with a C-terminal FLAG-tag ...
-
bioRxiv - Biochemistry 2024Quote: Anti-sera against recombinant ixochymostatin were raised in two rabbits (GenScript, Piscataway, NJ, USA). Total IgG was purified from sera by affinity chromatography (HiTrap™ Protein G HP - Cytiva ...
-
bioRxiv - Cell Biology 2023Quote: The pcDNA3.1-NR2A (catalog #: OHu24642D, NM_000833, human) and the pcDNA3.1-NR1 (catalog #: OHu22255D, NM_007327, human) plasmids were purchased from GenScript. The pcDNA3.1-BiP plasmid was provided by Dr ...
-
bioRxiv - Cell Biology 2023Quote: ... an SBP tag and the mRFP coding sequence was synthesized and cloned into pUC57-KanR (GenScript Inc.) and subcloned as an EcoRI-XBaI fragment into pUASTattB (Bischof et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... codon optimized mouse Pcbp2 clone with N-terminal Flag epitope tag was produced by gene synthesis (Genscript) and cloned in pcDNA3.1 (Invitrogen).
-
bioRxiv - Biochemistry 2023Quote: ... NM_032643.4) was cloned into the pcDNA3.1+/C-(K)-DYK vector with a C-terminal FLAG tag (GenScript). The cDNA of human STK25 isoform 1 (RefSeq accession no ...
-
bioRxiv - Neuroscience 2024Quote: ... Full-length cDNA encoding mouse PLCXD2 containing a C-terminal FLAG-tag in pcDNA3.1 (clone OMu06191, NM_001134480.1) was purchased from GenScript. The FLAG-tag was replaced with TdTomato to generate PLCXD2-TdTomato ...
-
bioRxiv - Biophysics 2024Quote: ... Protein was purified using Protein G resin (GenScript, L00209), concentrated to 2.5 mg/ml in TBS buffer ...
-
bioRxiv - Molecular Biology 2021Quote: ... All purification steps were monitored either by Coomassie-stained SDS-PAGE or anti-HIS western blot (Genscript #A00186). HMT assays were essentially performed as described in (Frapporti et al. ...
-
bioRxiv - Cell Biology 2021Quote: N-terminally Histidine (His)-tagged Bin1b SH3 from zebrafish was cloned into pET-28a (+) expression vector (GenScript®). Full length zebrafish Cavin4a (Cavin4a-FL ...
-
bioRxiv - Microbiology 2020Quote: ... and then incubated with 45 μL each of 0.1 μg/mL of THE anti-his-HRP (GenScript, A00612) in PBST/BSA for 1 hr at room temperature ...
-
bioRxiv - Plant Biology 2024Quote: Nucleotide sequences of His-tagged CYP71B mutants were chemically synthesized and subcloned into the pYeDP60 vector by GenScript Biotech (Netherlands) ...
-
bioRxiv - Biochemistry 2024Quote: ... Beads were eluted in 50 μL RAPPL wash buffer plus 1µl of TEV protease (TEV Protease His, Genscript) overnight at 4 rotating.
-
bioRxiv - Bioengineering 2021Quote: ... 2 mM CaCl2) using 10 U of Recombinant Bovine His6-Enterokinase (GenScript, Piscataway, NJ, USA) overnight at room temperature ...
-
bioRxiv - Biochemistry 2022Quote: cDNA constructs for expression of recombinant Mac-1 in mammalian cells were generated by GenScript. ITGAM cDNA was cloned into the vector pcDNA3.1/HygroB(+) ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Cell Biology 2021Quote: Codon optimized human SHIP164 generated by Genscript was amplified using PCR from the pUC57 plasmid and ligated into various mammalian and bacterial expression plasmids ...
-
bioRxiv - Genomics 2021Quote: ... human Hek293 DNA was purchased from Genscript. S ...
-
bioRxiv - Biophysics 2022Quote: Isoform 1 of human SERINC2 (GenScript-OHu23082D) was cloned into pFastBacI with the TEV and STREP cleavage and affinity tags upstream of the gene encoding hSERINC2 ...
-
bioRxiv - Neuroscience 2022Quote: Human Stathmin expression clones were from Genscript (STMN1-OHu14092D ...
-
bioRxiv - Microbiology 2020Quote: The fusion construct comEC-Twin strep tag (plasmid pED2385) was generated from a synthesized fragment purchased from Genscript USA that contained two strep tag II sequences ...
-
bioRxiv - Neuroscience 2021Quote: ... St3-Halo was generated by replacing the GFP in St3-GFP with Halo tag (GenScript USA Inc, NJ). The following reagents were used ...
-
bioRxiv - Biochemistry 2020Quote: ... Full-length codon-optimized yeast HSP104 fused C-terminally to an HA-tag was expressed from pcDNA3.1 (Genscript). Human codon-optimized HSPH1 fused C-terminally to a Myc-tag was expressed from pcDNA3.1 (Genscript) ...
-
bioRxiv - Microbiology 2021Quote: The CAN97-83 HMPV N0-P construct with a 6X C-terminal His6-tag was synthesized by GenScript in the pET-29b(+ ...
-
bioRxiv - Neuroscience 2020Quote: ... St3-Halo was generated by replacing the GFP in St3-eGFP with Halo tag (GenScript USA Inc, NJ). The following reagents were used ...
-
bioRxiv - Molecular Biology 2023Quote: ... basic coil motif (AQCKKKLQALKKKNAQLKWKLQALKKKLAQ) and 6xHIS tag inserted into a pcDNA3.1-Hygro(-)-like backbone was synthesized commercially (GenScript). The region encoding the α4 ectodomain (M1-Q970 ...
-
bioRxiv - Biophysics 2023Quote: ... LpMIP100-213 and Trypanosoma cruzi TcMIP with a His6-tag were obtained from GenScript (Piscataway Township, NJ, USA) and cloned into a pET11a vector ...
-
bioRxiv - Neuroscience 2024Quote: ... Tween20) for 1h and probed with the following primary antibodies: rabbit anti-DYKDDDDK-tag (1:2000, GenScript, #A00170) and mouse anti-actin (1:1000 ...
-
bioRxiv - Developmental Biology 2024Quote: MafB with an HA tag on the C-terminus followed by a stop codon was synthesized by GenScript and ligated into the pTRE2 vector ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... Detection of the captured human IgGs was performed with mouse anti-human IgG Fab-HRP (Genscript, Piscataway, NJ, USA) (1:5000 dilution in PBS 0.1 % casein) ...
-
bioRxiv - Developmental Biology 2024Quote: ... an additional leader peptide sequence for mammalian cell expression (MGWSCIILFLVATATGVHS) and the sequence to express six-His residues were cloned into a pcDNA3.1(+) expression vector from GenScript Giotech (Rijswijk ...
-
bioRxiv - Developmental Biology 2022Quote: ... residues A27-T157), human FZD7 CRD (UniProt: O75084, residues Q33-G170), human FZD8 CRD (UniProt: Q9H461, residues A28-T158) were synthesized (Genscript). Human LRP6 P1E1P2E2 (UniProt ...