Labshake search
Citations for GenScript :
951 - 1000 of 1128 citations for Recombinant Human PPAR gamma Protein His tag since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... cell culture media was clarified by centrifugation and the IgG captured using Protein G resin (Genscript). The IgG were eluted from the Protein G resin using 100 mM glycine pH 3.0 ...
-
bioRxiv - Neuroscience 2023Quote: ... Protein concentration from supernatants was measured and ran in 7.5% polyacrylamide gels using MOPS buffer (GenScript) at 130 V ...
-
bioRxiv - Microbiology 2023Quote: ... and visualized by Coomassie blue stain using the eStain protein stain system (GenScript, Piscataway, NJ, USA). Protein identity was verified by Edman degradation by the Protein Chemistry Section of the Research Technologies Branch ...
-
bioRxiv - Neuroscience 2024Quote: ... Proteins were separated by SDS-PAGE using 4%-20% MOPS-acrylamide gels (GenScript Express Plus M42012) and transferred electrophoretically onto Immobilon PVDF membrane (Merck) ...
-
bioRxiv - Microbiology 2024Quote: ... were generated via gene synthesis and cloned to produce 6xHis-tagged proteins by Genscript (Piscataway, NJ). Briefly ...
-
bioRxiv - Plant Biology 2024Quote: Purified proteins were separated using sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) (GenScript, Nanjing, China). The separated proteins were then electrotransferred onto a polyvinylidene fluoride (PVDF ...
-
bioRxiv - Molecular Biology 2024Quote: Proteins were electrophoresed in a 4-20% SurePAGE gel and Tris-MOPS-SDS running buffer (GenScript). Proteins were transferred to a nitrocellulose membrane in wet conditions (25 mM Tris base ...
-
bioRxiv - Plant Biology 2024Quote: Polyclonal antibodies against Arabidopsis proteins PIE1 (AT3G12810) and MBD9 (AT3G01460) were made using services from GenScript. The MBD9 protein fragment ‘MEPSILKEVGEPHNSSYFADQMGCDPQPQEGVGDGVTRDDETSSTAYLNKNQGKSP LETDTQPGESHVNFGESKISSPETISSPGRHELPIADTSPLVTDNLPEKDTSETLLKSVG RNHETHSPNSNAVELPTAHDASSQASQELQACQQDLSATSNEIQNLQQSIRSIESQLL KQSIRRDFLGTDASGRLYWGCCFPDENPRILVDGSISLQKPVQADLIGSKVPSPFLHTV DHGRLRLSPWTYYETETEISELVQWLHDDDLKERDLRESILWWKRLRYGDVQKEKKQ AQNLSAHHHHHH’ was expressed recombinantly and the PIE1 peptide fragment ‘CEEIRKAVFEERIQESKDRAAAI’ was synthesized for use as antigens in polyclonal antibody production in rabbits ...
-
bioRxiv - Immunology 2024Quote: ... Mice were immunized with SARS-CoV-2 Spike protein (5 µg, Val16-Pro1213, wild type, Genscript) with Alhydrogel® adjuvant 2% (InvivoGen ...
-
bioRxiv - Immunology 2024Quote: ... Cells were stimulated with an overlapping peptide pool derived from SARS-CoV-2 Spike protein (Genscript). Following 2 hours of culture ...
-
bioRxiv - Neuroscience 2024Quote: ... 30-50 μg of protein were loaded on or ExpressPlus™ PAGE 4–20% gels (GenScript), in MOPS running buffer or 7.5% ...
-
bioRxiv - Immunology 2024Quote: ... Supernatants containing expressed mAbs were collected and further purified with Protein-A magnetic beads (Genscript, L00695).
-
bioRxiv - Microbiology 2024Quote: ... Bound proteins were eluted off three times by incubation with 1x FLAG peptide (450ng/uL; Genscript) in 50 μL Wash buffer 2 ...
-
bioRxiv - Biophysics 2024Quote: The sequence for the Qβ phage coat protein lacking a stop codon was ordered from GenScript, Inc. ...
-
bioRxiv - Cancer Biology 2024Quote: ... to denature protein and loaded onto 4-12% GenScript SurePAGE™ Precast Gels (GenScript cat# M00653). The electrophoresis was run in Tris-MOPS-SDS running buffer (GenScript cat# M00138 ...
-
bioRxiv - Cell Biology 2024Quote: ... equal amounts of proteins were loaded and separated on a 4-20% SDS–PAGE (GenScript, M42015C). The proteins were transferred to PVDF membrane (Cytiva ...
-
bioRxiv - Immunology 2022Quote: Twenty 15-mer peptides (Figure 1A) used in human and mouse T-cell stimulation experiments were chemically synthesized by Genscript (TFA removal, >85% purity). The peptides were dissolved in DMSO at 20 mg/mL (∼12 mM) ...
-
bioRxiv - Immunology 2022Quote: ... The sequence of human IL-18BP (residues 1-194, UniProt ID: O95998) was purchased in the pUC57 vector at GenScript (GenScript, Piscataway, New Jersey, USA). The sequence was cloned in frame with a C-terminal caspase3 site followed by an AviTag and a His6 tag ...
-
bioRxiv - Immunology 2021Quote: ... the plates were washed with PBST four times followed by adding 100 µL 1:10,000 diluted HRP conjugated anti-human IgG antibodies (GenScript, Piscataway, NJ, USA; Cat # A00166) and incubating for 1 hour at room temperature ...
-
bioRxiv - Developmental Biology 2023Quote: ... Wild type or a mutant version of the human PDX1 enhancer with 6 CisBP predicted RFX binding motifs mutated (Weirach et al 2014) were commercially synthesized by Genscript (Genscript USA, Piscataway, NJ) and cloned into the pGL4.23 firefly luc2/miniP vector (Promega E8411) ...
-
bioRxiv - Biophysics 2021Quote: pET30a vectors encoding proteins WP_032523104.1 and OAD22177.1 (referred to as Pr12 and Pr17, respectively) were prepared by Genscript. Both proteins were produced without signal peptides (residues 1-22 for Pr12 and residues 1-18 for Pr17 ...
-
bioRxiv - Molecular Biology 2021Quote: ... with 1 ug of anti-UPF1 or anti-ARS2 antibodies and protein A/G magnetic beads (Genscript). The next day ...
-
bioRxiv - Biophysics 2022Quote: The full-length E-protein sequence from SARS-CoV-2 (GenBank Accession: NC_045512.2) was purchased from GenScript as a synthetic gene with optimized codon use for expression in Xenopus laevis ...
-
bioRxiv - Biophysics 2022Quote: The C terminal domain of Influenza A Matrix protein 1 (M1C) was subcloned into pET15b vector (GenScript). In addition to the M1C sequence ...
-
bioRxiv - Cell Biology 2020Quote: ... A total of 40 µg proteins were separated by 4-20% gradient SDS-PAGE gels (GenScript, M42015C) and transferred to PVDF membranes (Millipore ...
-
bioRxiv - Developmental Biology 2021Quote: ... Proteins were run on gradient pre-cast SDS polyacrylamide gels (8-16%, ExpressPlu, GenScript, M81610, Piscataway, USA) before being transferred to nitrocellulose membranes (0.45μm ...
-
bioRxiv - Microbiology 2021Quote: ... N501Y.V1 (Variant 1) mutant Spike proteins of SARS-CoV-2 were codon-optimized and synthesized by GenScript Inc (Nanjing ...
-
bioRxiv - Microbiology 2020Quote: ... the gene encoding the YpCntL protein was cloned in a pET-TEV plasmid (synthetic DNA from GenScript). After transformation ...
-
bioRxiv - Immunology 2020Quote: ... were coated in 1 carbonate buffer (0.1 M at pH 9.6) with 1.0 ug/ml S1 protein (GenScript). The plates were incubated overnight at 4°C in a humidified chamber and then blocked in PBS plus 0.05% Tween 20 (PBST ...
-
bioRxiv - Immunology 2020Quote: ... or 1-10 μg of Spike RBD protein (Sino Biological, Cat: 40592-V08H or GenScript, Cat: Z03483). “Mock” groups received PBS alone ...
-
bioRxiv - Cancer Biology 2023Quote: ... and the C-terminal DYK sequence of the DNase1L3 protein coding sequence from the DNase1L3_OHu20141D_pcDNA3.1+/C-(K)-DYK plasmid (Genscript). The obtained sequence was then inserted into the pmEGFP-N1 vector to construct DNase1L3ΔNT-EGFP ...
-
bioRxiv - Neuroscience 2023Quote: ... Purified monomer protein was subjected to two to three rounds of endotoxin removal (Endotoxin removal kit, GenScript) until a level of <0.1 EU per mg was achieved ...
-
Structural insight into guanylyl cyclase receptor hijacking of the kinase–Hsp90 regulatory mechanismbioRxiv - Biochemistry 2023Quote: ... The protein complex was eluted with the addition of 200 μg/mL of FLAG peptide (DYKDDDD) (GenScript). Protein was subsequently concentrated to >2 mg/mL and used for cryo-EM imaging.
-
bioRxiv - Plant Biology 2023Quote: ... Equal volumes of the solubilized protein fractions were detected by a polyclonal anti-GFP antibody (GenScript, USA). Rubisco large subunit was used as a loading control.
-
bioRxiv - Neuroscience 2023Quote: ... The resulting fusion protein with its corresponding SP-gRNA was cloned into the PX458 vector by GenScript. HA tag was included for detection of the fusion protein ...
-
bioRxiv - Immunology 2022Quote: ... and 5 μg protein per sample were separated in 10% SDS gels (SurePAGE Bis-Tris gels, GenScript) for approximately 10 min at 120 V ...
-
bioRxiv - Biochemistry 2022Quote: Protein co-expression constructs for Tlde1a with Tldi1a (Salmonella Typhimurium 14028s) were synthesized and subcloned by Genscript in the vector pETDUET-1 ...
-
bioRxiv - Biochemistry 2022Quote: ... Codon-optimized versions of the following protein sequences were synthesized and subcloned into the pET28a vector (GenScript): Different syntaxin-1a (1– 262 ...
-
bioRxiv - Genetics 2023Quote: Antibodies to all kinetochore proteins used in this study were custom-produced by GenScript (Piscataway, NJ, USA) or Biomatik (Cambridge ...
-
bioRxiv - Molecular Biology 2024Quote: ... Protein samples (20-40 μg) were then loaded and separated on SDS-polyacrylamide gradient gels (GenScript, M00654) followed by the transfer to polyvinylidene difluoride membranes (Merck ...
-
bioRxiv - Microbiology 2024Quote: ... and the proteins were transferred to a 0.22 µm PVDF membrane via a membrane transfer instrument (GenScript). The membrane was incubated with the primary antibody (RPS3 ...
-
bioRxiv - Immunology 2024Quote: ... vaccines consisted of 5 µg SARS-CoV-2 Spike RBD WH-01 (RBD) protein (GenScript, cat# Z03483) or 5 µg ovalbumin (OVA ...
-
bioRxiv - Cell Biology 2024Quote: A total of about 75 ng of proteins were loaded on 4-20% acrylamide gels (GenScript, M00655) and run at 120 V for 90’ in commercial Tris-MOPS-SDS running buffer (GenScript ...
-
bioRxiv - Biochemistry 2024Quote: ... proteins were transferred to polyvinylidene difluoride (PVDF) membrane by electroblotting using the eBlot L1 Blotting System (GenScript) and detected by immunoblotting ...
-
bioRxiv - Biophysics 2024Quote: The tail tube protein (TTP; WP:010328117) gene from Bacillus subtilis bacteriophage SPR was synthesized by GenScript and subsequently cloned into the pETDuet-1 vector ...
-
bioRxiv - Biochemistry 2024Quote: ... The fractions containing the protein were identified from Coomassie-stained 8-16% SDS-PAGE gradient gels (Genscript), pooled and diluted 3-fold with Buffer A ...
-
bioRxiv - Developmental Biology 2021Quote: ... Protein samples were separated by SDS-PAGE on 4-12% gradient gels (ExpressPlus, Genscript, New Jersey, NJ, USA). Each gel lane was cut into 6 equal slices ...
-
bioRxiv - Molecular Biology 2021Quote: The codon optimized genes encoding Argonaute proteins were ordered in pET29a expression vectors from GenScript (Piscataway, NJ, USA). Analytical amounts of twenty Argonaute proteins were synthesized from pET29a plasmids using PURExpress In Vitro Protein Synthesis kit (New England Biolabs ...
-
bioRxiv - Cancer Biology 2021Quote: ... 20 μg of total protein was separated by SDS– PAGE on 4-20% gradient ExpressPlus PAGE M42015 (GenScript) and transferred onto PVDF membranes using iBlot™ 2 Gel Transfer Device (Thermo Fisher Scientific) ...
-
bioRxiv - Biophysics 2020Quote: The C-terminal sequence of the envelope protein (residues 41–75, [NH2]-AYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV-[COOH]) was obtained from Genscript USA Inc. ...