Labshake search
Citations for GenScript :
51 - 100 of 215 citations for Dnp pro leu gly cys me his ala D arg nh2 since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2024Quote: ... Dicysteine peptide Ac-GCRDLPESGGPQGIWGQDRCG-NH2 (4S9 degradable sequence, MMP-degradable sequence) was purchased from Genscript (Piscataway, NJ), resuspended in 10% glacial acetic acid ...
-
bioRxiv - Synthetic Biology 2020Quote: ... The His-tagged GMCSF peptide was quantified using a His Tag ELISA Detection Kit (GenScript) according to the provided protocol and 5-10 fold dilutions of frozen samples.
-
bioRxiv - Microbiology 2021Quote: ... His-tagged AtxA was detected using anti-His antibody (GenScript USA Inc., Piscataway, NJ, USA). RNA polymerase subunit β was used as a loading control and detected using anti-RNAP antibody (Thermo fisher ...
-
bioRxiv - Biochemistry 2024Quote: ... pET15b hDHRSX-N-His (NM_145177.3) and pcDNA3.1(+) hSRD5A3-N-His (NM_024592.5) were purchased from GenScript Biotech (Rijswijk ...
-
bioRxiv - Microbiology 2024Quote: ... AA 1-154) of Aquifex aeolicus were fused by a Gly-Ser linker and constructed in a pUC57 plasmid by GenScript USA ...
-
bioRxiv - Biophysics 2020Quote: The C-terminal sequence of the envelope protein (residues 41–75, [NH2]-AYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV-[COOH]) was obtained from Genscript USA Inc. ...
-
bioRxiv - Biochemistry 2022Quote: ... 0.2mg/ml BSA with either fixed or varying concentrations of either the peptide substrate (Biotin-GGGENWYNTLKRKK-NH2) (Genscript) or ATP spiked with 0.8μCi [γ 32P]-ATP (Perkin Elmer) ...
-
bioRxiv - Bioengineering 2023Quote: ... μgels formulated using HA-NB (3.4 wt% (w/v)) precursor solution in 0.3 M HEPES buffer with 3.5 mM MMP-cleavable crosslinker (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript), 1.75 mM Tris(2-carboxyethyl)phosphine hydrochloride (TCEP ...
-
bioRxiv - Plant Biology 2022Quote: ... His-FmASP protein was detected by immunoblotting with using a mouse anti-His antibody (GenScript, A00186). The immunoblotting band signals were visualized by enhanced enhanced chemiluminescence (ECL ...
-
bioRxiv - Microbiology 2020Quote: ... THE™ Anti-His-HRP (Genscript).
-
bioRxiv - Plant Biology 2023Quote: ... Hexa-His peptide (Genscript, Inc., NJ) was used as a control ...
-
bioRxiv - Microbiology 2023Quote: ... An unconjugated Anti-HIS antibody (Genscript) was added (5.0 mg/mL ...
-
bioRxiv - Biochemistry 2023Quote: ... The pESC-HIS-hMfsd7c plasmid (Genscript) was used for overexpression on the yeast S ...
-
bioRxiv - Cell Biology 2023Quote: ... using MES-SDS running buffer (GenScript Cat. #M00677). The proteins were transferred on 0.2 µm pore-diameter Immobilon–pSQ PVDF membrane (Cat ...
-
bioRxiv - Biophysics 2024Quote: DNA constructs encoding Aha TRAP-(linker)-TRAP-(TEV cleavage site)-His6 with varying length Gly/Ser linkers were obtained commercially (GenScript, Inc) in a pET21a (Novagen ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... the cross-linker solution was prepared by dissolving the di-thiol matrix metalloproteinase sensitive peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) in distilled water at 12 mM and reacted with 10 μM Alexa-Fluor 647-maleimide (Invitrogen ...
-
bioRxiv - Bioengineering 2023Quote: ... The cross-linker solution was prepared by dissolving the di-thiol matrix metalloproteinase-sensitive peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) GenScript ...
-
bioRxiv - Bioengineering 2022Quote: ... A mouse anti-His-Tag antibody (GenScript) was diluted 1:100 and used as the primary antibody ...
-
bioRxiv - Microbiology 2024Quote: ... using anti-His (mouse) primary antibody (GenScript) at a dilution of 1:3,000 ...
-
bioRxiv - Immunology 2024Quote: ... and CD8α (PVFLMYIGTRTKIAEGLESQISGQKFQNDG) were synthesized with N-terminal Cys and conjugated to keyhole limpet hemocyanin (KLH; GenScript). Hybridomas were produced by immunizing two BALB/c mice for each target intraperitoneally with 25 μg of the peptide-KLH or IgG (H&L chains ...
-
bioRxiv - Biophysics 2024Quote: ... DNA encoding Cys-RLC was synthesized and subcloned into the pET28b expression vector by GenScript (Piscataway, NJ). This expression plasmid also contains a 6-His tag followed by a TEV protease cleavage site on the N-terminus of the Cys-RLC ...
-
bioRxiv - Biochemistry 2021Quote: ... to reflect the reducing conditions in the cytoplasm of the cell) and AQP4ct (Ac-256VEFKRRFKEAFSKAAQQTKG SYMEV280-NH2) peptides were synthesized by Genscript Inc ...
-
bioRxiv - Biochemistry 2021Quote: ... The H4 substrate peptide used in the assay corresponds to the first 19 residues of human H4 (NH2-SGRGKGGKGLGKGGAKRHR-COOH; GenScript). In the assay ...
-
bioRxiv - Biochemistry 2021Quote: ... 100 nM of hNatA was mixed with 30 μM of [14C]acetyl-CoA and 30 μM of either H4 peptide or SASE peptide (NH2-SASEAGVRWGRPVGRRRRP-COOH; GenScript), with none ...
-
bioRxiv - Biochemistry 2021Quote: 300 nM of hNatE was mixed with 50 μM [14C]acetyl-CoA and 100 μM of MLGP peptide (NH2-MLGPEGGRWGRPVGRRRRP-COOH, GenScript), with none ...
-
bioRxiv - Biochemistry 2021Quote: 50 nM of SpNatC was mixed with 30 μM [14C]acetyl-CoA and 10 μM of MLRF peptide (NH2-ML RFVTKRWGRPVGRRRRPCOOH, GenScript), with none ...
-
bioRxiv - Biochemistry 2021Quote: 100 nM of hNatB was mixed with 50 μM [14C]acetyl-CoA and 50 μM of MDVF peptide (NH2-MDVFMKGRWGRPVGRRRRP-COOH, GenScript), with none ...
-
bioRxiv - Microbiology 2021Quote: ... RBD-binding peptide SBP1 derived from human ACE2 α helix 1 (Ac-IEEQAKTFLDKFNHEAEDLFYQS-NH2) was synthesized by GenScript (Nanjing, China).
-
bioRxiv - Pharmacology and Toxicology 2021Quote: Mpro inhibition assay was performed using the FRET-based fluorescent peptide substrate DABCYL-KTSAVLQ↓SGFRKM-E(EDANS)-NH2 (purchased from Genscript). The assay was standardized with enzyme concentration of 140 nM and 30 µM of fluorescent substrate in Mpro assay buffer containing (20 mM Tris pH 7.3 ...
-
bioRxiv - Biochemistry 2020Quote: Immunogen peptide S2 (ACNH-CGAGT(AMP)GAG-NH2) was conjugated with KLH and BSA as immunogen via its N-terminal cysteine (GenScript).
-
bioRxiv - Cancer Biology 2023Quote: ... the PEG was functionalized by incubating the 10 kDa 8arm PEG vinyl sulfone (JemKem Technology) with Ac-FKGG-GDQGIAGF-ERCG-NH2 (TG-NDG-Lys) or H-NQEQVSPL-ERCGNH2 (TG-Gln) peptides (GenScript) in triethanolamine (0.3 M ...
-
bioRxiv - Biochemistry 2023Quote: The genes encoding full-length TcdB toxin variants (TcdB1,3 and 4) were synthesized with a C-terminal His-tag and cloned into pC-His 1622 by Genscript. The pC-His1622 vector was purchased from MoBiTec ...
-
bioRxiv - Biochemistry 2024Quote: Synthetic genes with N-terminal histidine tag (either 6-His or 10-His for ROCKETAAXWA) were synthesized by Genscript Inc or derived from mutagenesis in a pet26b (+ ...
-
bioRxiv - Synthetic Biology 2022Quote: ... linker with both N-terminal and C-terminal 10×His-tags with a cysteine adjacent to each 10×His tag in a pET21b vector (Genscript). The plasmid was transformed into T7 express cells (NEB ...
-
bioRxiv - Biochemistry 2023Quote: ... The successful removal of His-tag was validated by western blot using the anti-His-tag antibody (Genscript, A00186-100).
-
bioRxiv - Bioengineering 2024Quote: Recombinant human his-MBP-ADAR2 (UniProt ID: X UP000005640 and His-MBP-ADAR1 (UniProt ID: UP000005640) were expressed and purified by GenScript. ADAR2 was purified using Ni-NTASuperdex 200 16/600 pg His-MBP-ADA ...
-
bioRxiv - Bioengineering 2020Quote: ... HRP-conjugated secondary antibodies against His-tag (Genscript) were diluted 1:5,000-10,000 and incubated with the well for 1 hr at room temperature ...
-
bioRxiv - Microbiology 2020Quote: ... Mouse α-His antibody (1:1000, Genscript A00186) in TBST buffer with 0.5% BSA and goat α-mouse IgG (H+L ...
-
bioRxiv - Plant Biology 2022Quote: ... specific rabbit His-tag antibody (GenScript, A00174-40) or anti-monoubiquityl-histone H2B (Lys-120 ...
-
bioRxiv - Biophysics 2020Quote: ... To determine the binding affinities between antigens and antibody mouse monoclonal anti-His-tag IgG (clone 6G2A9, The™ His tag Ab, GenScript) was captured on the surface of active flow cell to the level of 100-200 RU ...
-
bioRxiv - Bioengineering 2023Quote: ... the aqueous phase consisted of 10 kDa 8-arm PEG-vinyl sulfone (PEG-VS) (JenKem, Plano, TX) and RGD (Ac-RGDSPGERCG-NH2, Genscript, Piscataway, NJ) in 100 mM HEPES buffer (N-2-hydroxyethylpiperazine-N’-2-ethanesulfonic acid ...
-
bioRxiv - Biochemistry 2023Quote: ... Equilibrated Ni-NTA resin was added to the products to bind the MBP-His tag and the His-tagged TEV protease (Genscript, Cat. # Z03030) while allowing the purified FAM210A-dMTS cleaved product to be collected in the flowthrough ...
-
bioRxiv - Synthetic Biology 2023Quote: The expression levels of his-tagged nanobodies resulting from microfermentations were quantified using the His tag ELISA detection kit (GenScript, Cat# L00436) according to the manufacturer’s protocol ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... 1:200 iFluor647-conjugated mouse anti-His (Genscript A01802) for civet ACE2 ...
-
bioRxiv - Biochemistry 2020Quote: ... and Western blot analysis using anti-His (A01620, Genscript) and anti-PSA-NCAM (MAB5324 ...
-
bioRxiv - Synthetic Biology 2020Quote: ... the mouse anti-His (A00186, GenScript, 1:5000 diluted), and the rabbit anti-HA (902303 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... Untagged ANXA1 was isolated by His-tagged enterokinase (Genscript) treatment followed by Ni-affinity chromatography ...
-
bioRxiv - Microbiology 2024Quote: ... and incubated with a α-HIS antibody (Genscript A00186), followed by HRP-conjugated α-mouse antibody (Abclonal AS003) ...
-
bioRxiv - Microbiology 2024Quote: ... and incubated with mouse α-HIS antibody (Genscript A00186). Proteins were detected using HRP-conjugated goat α-mouse antibody (Abclonal AS003) ...
-
bioRxiv - Biophysics 2023Quote: The peptides CPSF6313–327 (CPSF6p) and CPSF6313–327 with an extra cysteine at the C-terminus (CPSF6p-Cys) were synthetized by GenScript. Peptides were dissolved in water at a concentration of 2.5 mM and stored in aliquots at -40°C.