Labshake search
Citations for GenScript :
1 - 50 of 215 citations for Dnp pro leu gly cys me his ala D arg nh2 since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2021Quote: AngII and TRV023 (Sar-Arg-Val-Tyr-Lys-His-Pro-Ala-OH) were synthesized by GenScript USA (Piscataway ...
-
bioRxiv - Biochemistry 2023Quote: ... coupled to a Gly-Gly-Gly-Cys peptide (Genscript). The next morning ...
-
bioRxiv - Biophysics 2023Quote: A Gly-Gly-Gly-Cys peptide with C-terminal amidation (Genscript) was dissolved at 173 mM in degassed coupling buffer (50 mM HEPES (pH 7.4) ...
-
bioRxiv - Genomics 2023Quote: ... Mutagenesis of the palmitoylation site (aa Cys 820 into Ala) was done by GenScript Biotech (Netherlands ...
-
bioRxiv - Biochemistry 2024Quote: The peptidase activity of the 20S CP was measured using a pair of substrates: the tripeptide benzyloxycarbonyl-Val-Leu-Arg-7-amino-4-methylcoumarin (Z-VLR-AMC, Genscript) and a 11-residue oligopeptide conjugated to 7-methoxycoumarin-4-acetic acid referred to as LF211 (7-methoxycoumarin4-acetic acid (MCA)-Lys-Lys-Val-Ala-Pro-Tyr-Pro-Met-Glu-(dinitrophenyl)diaminopropionyl-NH2 ...
-
bioRxiv - Biochemistry 2021Quote: The tetramethylrhodamine (TMR) labeled peptide with sequence Gly-Gly-GLy-Ser-{Lys-(TMR)}was purchased from Genscript. Its mass ...
-
bioRxiv - Neuroscience 2024Quote: ... MTFL457 (Ac-YGRKKRRQRRRHSKFGMKGPASVIS-NH2) or MTFL457AAA (Ac-YGRKKRRQRRRHSAAAMKGPASVIS-NH2) (>95% purity; GenScript) were retro-orbitally injected 10 min after damage initiation ...
-
bioRxiv - Neuroscience 2022Quote: ... Cys-TAT (CYGRKKRRQRRR) and RVG-Cys (YTIWMPENPRPGTPCDIFTNSRGKRASNGC) were synthesized by Genscript. Nuclear localization signal (NLS)-tagged Streptococcus pyogenes Cas9 nuclease (sNLS-SpCas9-sNLS ...
-
bioRxiv - Cancer Biology 2022Quote: ... SLIGRL-NH2 (PAR2) and AYPGKF-NH2 (PAR4) (≥95% purity by HPLC) were synthesized by GenScript. PAR1 selective antagonist vorapaxar was purchased from Adooq Bioscience ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... and RGD (Ac-RGDSPGERCG-NH2, GenScript) for at least one hour at 37°C ...
-
bioRxiv - Bioengineering 2023Quote: ... K-peptide (Ac-FKGGERCG-NH2, GenScript), Q-peptide (Ac-NQEQVSPLGGERCG-NH2 ...
-
bioRxiv - Bioengineering 2023Quote: ... and RGD (Ac-RGDSPGERCG-NH2, GenScript) in 0.3 m triethylamine (Sigma ...
-
bioRxiv - Bioengineering 2023Quote: ... K-peptide (Ac-FKGGERCG-NH2, GenScript), Q-peptide (Ac-NQEQVSPLGGERCG-NH2 ...
-
bioRxiv - Bioengineering 2023Quote: ... Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript), and RGD (Ac-RGDSPGERCG-NH2 ...
-
bioRxiv - Bioengineering 2023Quote: ... Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript) and RGD (Ac-RGDSPGERCG-NH2 ...
-
bioRxiv - Bioengineering 2023Quote: ... and RGD (Ac-RGDSPGERCG-NH2, GenScript) in 0.3 M triethylamine (Sigma ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... and Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript) and RGD (Ac-RGDSPGERCG-NH2 ...
-
bioRxiv - Biophysics 2020Quote: ... 10 nM NS2B-NS3pro was incubated with the substrate benzoyl-Nle-Lys-Arg-Arg-7-amino-4-methylcoumarin (Bz-nKRR-AMC) (Genscript) at concentrations varying from 2 to 200 µM ...
-
bioRxiv - Bioengineering 2020Quote: ... and 1 mM RGD (Ac-RGDSPGERCG-NH2) (GenScript). The other solution contained an 8mM di-cysteine modified Matrix Metalloprotease (MMP ...
-
Exploring the Role of Spatial Confinement in Immune Cell Recruitment and Regeneration of Skin WoundsbioRxiv - Bioengineering 2023Quote: ... with 500 µM RGD (Ac-RGDSPGERCG-NH2, GenScript), 500 µM K-peptide (Ac-FKGGERCG-NH2 ...
-
Exploring the Role of Spatial Confinement in Immune Cell Recruitment and Regeneration of Skin WoundsbioRxiv - Bioengineering 2023Quote: ... 500 µM K-peptide (Ac-FKGGERCG-NH2, GenScript) and 500 µM Q-peptide (Ac-NQEQVSPLGGERCG-NH2 ...
-
bioRxiv - Biochemistry 2024Quote: ... and γ-glu-ser-gly were custom synthesized from GenScript.
-
bioRxiv - Bioengineering 2021Quote: ... and 5 mM RGD peptide (Ac-RGDSPGERCG-NH2, Genscript) in PBS at a rates of 0.5 - 5 µL/min ...
-
Exploring the Role of Spatial Confinement in Immune Cell Recruitment and Regeneration of Skin WoundsbioRxiv - Bioengineering 2023Quote: ... and 500 µM Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript) and crosslinked at a 0.6 VS to thiol ratio with di-thiol matrix metalloproteinase sensitive peptide (GenScript ...
-
bioRxiv - Biochemistry 2022Quote: cDNA encoding His6-TEV-pro-conA sequence was synthesized and sub-cloned into pET28a(+) in framed with the N-terminal His-tag (Genscript), followed by transformation into Rosetta PLysS competent cells (Novagen) ...
-
bioRxiv - Bioengineering 2020Quote: ... pre-functionalized with 500μM K-peptide (Ac-FKGGERCG-NH2) (GenScript), 500 μM Q-peptide (AcNQEQVSPLGGERCG-NH2) ...
-
bioRxiv - Molecular Biology 2024Quote: Synthetic Aβ40 (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-NH2) was purchased from GenScript (Rijswijk, Netherlands). Stock solutions were prepared by dissolving 1 mg of the peptide to a final concentration of 250 μM and adding 20 mM sodium phosphate buffer ...
-
bioRxiv - Physiology 2020Quote: Annexin A1 tripeptide fragment (Ac-Gln-Ala-Trp) (ANXA1sp) was synthesized by GenScript Biotech (Piscataway ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... pH 8.8 and pre-reacted with K-peptide (Ac-FKGGERCG-NH2, GenScript) and Q-peptide (Ac-NQEQVSPLGGERCG-NH2 ...
-
bioRxiv - Microbiology 2021Quote: ... The FRET-pair substrate Abz-LPETG-Dap(Dnp)-OH (Genscript, Piscataway, NJ, Unites States) and the tetraglycine (Sigma Aldrich ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... SLIGRL-NH2 (> 95% purity by HPLC/MS) was purchased from Genscript (Piscataway, NJ) or EZBiolabs (Carmel ...
-
bioRxiv - Bioengineering 2021Quote: ... and 14.1mg/mL di-cysteine modified Matrix Metallo-protease (MMP) (Ac-GCRDGPQGIWGQDDRCG-NH2) (Genscript) peptide substrate were used to form MMP-degradable PicoShells.
-
bioRxiv - Neuroscience 2021Quote: ... melanogaster Crz (pQTFQYSRGWTN-NH2) was custom synthesized at >95% purity by Genscript (Piscataway, NJ, USA); a non-amidated adipokinetic hormone/corazonin-related peptide (naACP ...
-
bioRxiv - Bioengineering 2023Quote: ... The crosslinker solution was prepared by dissolving the MMP-cleavable peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) in distilled water at 12 mm and 10 μm Alexa-Fluor 647-maleimide (Invitrogen) ...
-
bioRxiv - Immunology 2023Quote: ... Peptides TAT-HKII (MIASHMIACLFTELN(β-Ala)GYGRKKRRQRRG-amide) and TAT (GYGRKKRRQRRG-amide) were custom-made by GenScript.
-
bioRxiv - Microbiology 2020Quote: ... 50 ng of His-tagged RBD (His-RBD, aa 319-541) (Genscript) was then added to each well and incubated at 37°C for 2 hours ...
-
bioRxiv - Microbiology 2024Quote: ... His and FLAG tagged ubiquitin (His-FLAG-UbK0) was generated by GenScript Biotech ...
-
bioRxiv - Biochemistry 2022Quote: ... anti-His tag (Genscript) or anti-FLAG (Genscript ...
-
bioRxiv - Microbiology 2023Quote: ... using MES SDS running buffer (GenScript) in a Bio-Rad Mini-PROTEAN Tetra Cell (BioRad ...
-
bioRxiv - Biochemistry 2023Quote: ... and MES-SDS running buffer (GenScript) followed by staining using the eStain L1 Protein Staining System (GenScript) ...
-
bioRxiv - Neuroscience 2024Quote: ... in MES-SDS running buffer (Genscript) at 125V for 45 min ...
-
bioRxiv - Cell Biology 2024Quote: ... in 1X MES Running Buffer (Genscript) according to manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2021Quote: The antibodies used were: monoclonal anti-His THE HIS Tag (GenScript, Piscataway, NJ); monoclonal anti-HA (BioLegend ...
-
bioRxiv - Immunology 2022Quote: His tag-IP was performed using anti-His affinity resin (GenScript L00439-1) and Myc tag-IP was performed using anti-Myc affinity resin ...
-
bioRxiv - Bioengineering 2020Quote: ... The other solution contained an 8mM di-cysteine modified Matrix Metalloprotease (MMP) (Ac-GCRDGPQGIWGQDRCG-NH2) (GenScript) substrate with either all L-chirality amino acid residues for L-MMP microgels or D-chirality amino acid substitution of amino acids at the site of MMP-mediated recognition and cleavage (Ac-GCRDGPQDGIDWDGQDRCG-NH2 ...
-
bioRxiv - Microbiology 2021Quote: ... Anti-His-HRP (Genscript, A00612), Avidin-HRP (Biolegend ...
-
bioRxiv - Microbiology 2020Quote: ... Anti-His-HRP (Genscript, A00612), Avidin-HRP (Biolegend ...
-
bioRxiv - Microbiology 2023Quote: ... anti-His (1:4,000) (GenScript), anti-GFP (1:10,000 ...
-
bioRxiv - Biochemistry 2024Quote: ... His-tagged Enterokinase (Z03004, Genscript) was added to the dialyzed ...
-
bioRxiv - Bioengineering 2024Quote: ... Dicysteine peptide Ac-GCRDLPESGGPQGIWGQDRCG-NH2 (4S9 degradable sequence, MMP-degradable sequence) was purchased from Genscript (Piscataway, NJ), resuspended in 10% glacial acetic acid ...