Labshake search
Citations for GenScript :
51 - 100 of 246 citations for DNA Standards since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2022Quote: ... a synthetic DNA fragment (GenScript®) containing BAP tag in VP4 loops in amino acid regions 96-101 ...
-
bioRxiv - Genomics 2019Quote: ... we inserted a DNA fragment (Genscript) containing 4 different gRNAs targeting the mCD8 protein tag ...
-
bioRxiv - Genomics 2019Quote: ... a DNA fragment was synthetized (Genscript), which contained 4 gRNAs (6 for Exon2 ...
-
bioRxiv - Cell Biology 2020Quote: ... a pool of DNA oligonucleotides (GenScript) was used ...
-
bioRxiv - Biochemistry 2022Quote: ... and a synthesized DNA fragment (GenScript) was used as PCR template.
-
bioRxiv - Biophysics 2022Quote: ... DNA fragments were synthesized by GenScript and cloned into a bacterial expression vector for overexpression and purification (see below) ...
-
bioRxiv - Microbiology 2023Quote: ... Custom synthesized DNA (GenScript, Piscataway, NJ) bearing the N- and C-terminal mutations were amplified with dcas9_mut1_ F/R and dcas9_mut2_F/R (Supplemental Data 1).
-
bioRxiv - Biochemistry 2023Quote: ... dCGCGCG DNA was synthesized by Genscript, and a 1.5 mM solution of DNA in water was annealed at a temperature of 65 °C for 12 minutes ...
-
bioRxiv - Immunology 2020Quote: ... The protein purity and molecular weight were determined by standard SDS-PAGE along with Western blot confirmation using a Rabbit anti-GST pAb (GenScript, Cat.No. A00097). Recombinant GST-IdeZ was stored in 50 mM Tris-HCl ...
-
bioRxiv - Immunology 2021Quote: RBD and NP end-point titers were determined using standard ELISA and plates coated with 500 ng/mL SARS-CoV-2 Spike-protein Receptor-Binding Domain (RBD) (GenScript, Piscataway NJ) or 1ug/mL SARS-CoV-2 nucleocapsid protein (NP) ...
-
bioRxiv - Immunology 2021Quote: RBD end-point titers were determined using standard ELISA and plates were coated with 500 ng/mL SARS-CoV-2 Spike-protein Receptor-Binding Domain (RBD) (GenScript, Piscataway NJ) Heat inactivated plasma (1:50 in blocking buffer ...
-
bioRxiv - Immunology 2020Quote: DNA constructs were prepared using conventional methods based either on synthetic DNA (Twist, IDT) or purchased commercially (Genscript) or clones from plasmids with viral proteins generously provided by Prof ...
-
bioRxiv - Biochemistry 2020Quote: ... Synthetic DNA fragments were synthesized by Genscript, Inc ...
-
bioRxiv - Immunology 2021Quote: ... and Nlrp1b2 DNA was purchased from Genscript (OHu26815D ...
-
bioRxiv - Microbiology 2019Quote: ... iii) rGαi-wt Synthetic DNA fragment (GenScript) encoding for E ...
-
bioRxiv - Microbiology 2019Quote: ... we used a synthetic DNA fragment (Genscript) of 712 bp in length termed p6122 ...
-
bioRxiv - Genomics 2021Quote: ... human Hek293 DNA was purchased from Genscript. S ...
-
bioRxiv - Immunology 2023Quote: ... A synthetic codon-optimized DNA sequence (Genscript) encoding murine Ym2 (Uniprot Q91Z98 ...
-
bioRxiv - Immunology 2023Quote: A synthetic codon-optimized DNA sequence (Genscript) encoding murine Ym1 (Uniprot ID O35744 ...
-
bioRxiv - Plant Biology 2024Quote: ... 1 unit of Taq DNA polymerase (GenScript). PCR was conducted at 94 °C for 3 min for denaturation followed by 35-40 cycles of 94 °C for 30 sec ...
-
bioRxiv - Molecular Biology 2023Quote: ... The DNA templates were synthesized by GenScript or constructed via the Gibson assembly method (primers for cloning are listed in Table S2 ...
-
bioRxiv - Microbiology 2024Quote: ... DNA fragments were synthesized de novo (Genscript) and amplified by PCR ...
-
bioRxiv - Microbiology 2021Quote: ... The plasmid pModProm1-TiR1-TY1-3DHFR (DNA sequence in Supplementary Table 5 was DNA synthetized and then cloned in pUC57 simple by Genscript. The chimeric construct was inserted within the UPRT locus ...
-
bioRxiv - Microbiology 2023Quote: ... DNA fragments with the mutated or deleted gene allele plus 500 bp flanking DNA were synthesized (Genscript, New Jersey USA) or generated by PCR using primer-incorporated restriction enzyme sites ...
-
bioRxiv - Biochemistry 2021Quote: ... linear DNA knock-in cassette was synthesized (GenScript). The vectors pCas and pTargetF were gifts from Sheng Yang (Addgene plasmids #62225 and #62226) ...
-
bioRxiv - Microbiology 2020Quote: ... DNA fragments with swapped SPs were synthesized (Genscript) and digested using EcoRI (in pNL4.3 backbone ...
-
bioRxiv - Microbiology 2020Quote: ... was obtained as synthetic DNA fragment from GenScript Biotech (Netherlands ...
-
bioRxiv - Biochemistry 2022Quote: DNA plasmids for artemin were prepared by Genscript using their custom gene synthesis and cloning services ...
-
bioRxiv - Biophysics 2022Quote: ... DNA sequence encoding V2HeR3 was purchased from GenScript Japan (Tokyo ...
-
bioRxiv - Developmental Biology 2019Quote: ... using a combination of DNA synthesis (Genscript Inc), Gibson assembly (NEB ...
-
bioRxiv - Biochemistry 2020Quote: ... The DNA construct was chemically synthesized (Genscript, NJ) and cloned into a pET-22b vector with an N-terminal His6 – Sumo cleavable tag ...
-
bioRxiv - Microbiology 2021Quote: ... Green Taq DNA polymerase with provided buffers (GenScript) was used for pltB ...
-
bioRxiv - Microbiology 2022Quote: ... and each DNA fragment was commercially synthesized (GenScript). A T7 promoter sequence was introduced at the 5′ end of fragment A ...
-
bioRxiv - Microbiology 2023Quote: ... and each DNA fragment was commercially synthesized (GenScript). A T7 promoter sequence was introduced at the 5’ end of fragment A ...
-
bioRxiv - Molecular Biology 2023Quote: ... DNA sequences were purchased from GenScript (Cdc3G, Cdc10G) and Synbio Technologies™ (Cdc10Δ1-10) ...
-
bioRxiv - Molecular Biology 2024Quote: ... DNA fragments with wild type or mutation MTB DNA sequences were synthesized and cloned into pUC19 plasmid by GenScript (Figure 2). Concentrations of these plasmids are quantified by Bio-Rad ddPCR platform following the user guide ...
-
bioRxiv - Biochemistry 2022Quote: ... coli and synthesized (Genscript Inc, Integrated DNA Technologies Inc) with NdeI site on the 5’ end and a termination codon (TAA or TAG ...
-
bioRxiv - Biophysics 2021Quote: ... All DNA oligonucleotides were purchased from GenScript (Piscataway, USA). Equimolar amounts of positive and negative sense ssDNAs were dissolved in buffer and annealed by heating to 50 °C for 10 min and slowly cooling to room temperature ...
-
bioRxiv - Microbiology 2019Quote: ... was generated with a GenParts™ DNA Fragment (GenScript) containing NSP5 ORF lacking the amino acids 80-130 (VKTNADAGVSMDSSAQSRPSSNVGCDQVDFSLNKG LKVKANLDSSISIST ...
-
bioRxiv - Synthetic Biology 2021Quote: DNA used in the study was synthesized by Genscript and IDT ...
-
bioRxiv - Genetics 2021Quote: ... Stb1-18Ala is a synthetic DNA constructed by Genscript, which replaces all Ser and Thr residues shown in yellow in Fig ...
-
bioRxiv - Neuroscience 2020Quote: ... The DNA of GCaMP6m was synthesized (GenScript, Piscataway, NJ) according to the reported amino acid sequence (Chen et al. ...
-
bioRxiv - Molecular Biology 2021Quote: ... Coding DNA encoding the VNAs was synthesized by Genscript with restriction sites compatible with insertion in frame into a mammalian expression vector based on pSecTag2 ...
-
bioRxiv - Immunology 2021Quote: ... The optimized DNA sequence was synthesized (Genscript, Piscataway NJ), digested with BamHI and XhoI ...
-
bioRxiv - Microbiology 2022Quote: ... PCR amplifications were performed with Taq DNA Polymerase (GenScript) according to the manufacturer’s instructions.
-
bioRxiv - Immunology 2022Quote: ... DNA sequences encoding the genes were purchased from GenScript, amplified by polymerase chain reaction (PCR) ...
-
bioRxiv - Immunology 2022Quote: ... DNA sequences encoding the genes were purchased from GenScript, amplified by polymerase chain reaction (PCR) ...
-
bioRxiv - Neuroscience 2023Quote: ... DNA fragment synthesis and cloning were performed by GenScript. pLV-hSyn-glGFP were generated by removing the AgeI-RFP-PmeI insert of pLV-hSyn-RFP and ligating an AgeI-green lantern GFP -PacI-PmeI synthetic fragment ...
-
bioRxiv - Immunology 2023Quote: ... DNA sequences encoding the genes were purchased from GenScript, amplified by polymerase chain reaction (PCR) ...
-
bioRxiv - Neuroscience 2023Quote: ... A single-stranded DNA repair construct (synthesized by Genscript) with the sequence 5’- CTGGGCTGACAAACATCAAGACGGAAGAGATCTCGGAAGTGAAGATGGATGCAGA ATTCCGACATGATTCAGGATATGAAGTCCATCATCAAAAACTGGTAGGCAAAAATAAACTGCCTCTCCCCGAGATTGCGTCTGGCCAGATGAAAT-3’ was used to introduce the G601R ...