Labshake search
Citations for GenScript :
901 - 950 of 1292 citations for Mouse Anti Dengue Virus Envelope Protein Serotype 1 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2023Quote: ... The synthetic peptides AM1 (theoretical Mw = 2472 g·mol-1) and SurSi (theoretical Mw = 3632 g·mol-1) were designed in our lab and synthesized by GenScript® (Nanjing ...
-
bioRxiv - Immunology 2024Quote: ... G12V-TCR alpha chain (1-206) and G12V-TCR beta chain (1-246) were synthesized by Genscript (USA) and cloned into the pET30a+ vector ...
-
bioRxiv - Neuroscience 2021Quote: ... 1 μM CabTRP Ia (GenScript, Piscataway, NJ) was added to the saline ...
-
bioRxiv - Biochemistry 2020Quote: 2 µg GST (GenScript; Cat. # Z02039-1), ubiquitin (R&D Systems ...
-
bioRxiv - Biochemistry 2021Quote: ... The cDNAs of GALNTs 1-20 (Genscript) were amplified by PCR and digested by BamHI and NotI (GALNT1 ...
-
bioRxiv - Microbiology 2020Quote: ... 1:250 (GenScript, catalog no. A01658-40), mouse anti-HA 1:500 (BioLegend ...
-
bioRxiv - Biophysics 2022Quote: Isoform 1 of human SERINC2 (GenScript-OHu23082D) was cloned into pFastBacI with the TEV and STREP cleavage and affinity tags upstream of the gene encoding hSERINC2 ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 10 μM ET-1/ IRL1620 (GenScript) for 1.5 h at room temperature (RT) ...
-
bioRxiv - Immunology 2022Quote: ... or rabbit (GenScript, A00098, 1:2,000 diluted) IgG was added and then developed with 3,3’,5,5’ -tetramethylbenzidine (TMB ...
-
bioRxiv - Neuroscience 2023Quote: ... which was bought from GenScript (Table 1).
-
bioRxiv - Neuroscience 2023Quote: ... Tat-beclin 1 (YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT) (7.5 µg, Genscript) or tat-scrambled (YGRKKRRQRRRGGVGNDFFINHETTGFATEW ...
-
bioRxiv - Immunology 2023Quote: ... Streptavidin-HRP (GenScript, M00091; 1:5000 dilution) was added to the wells and incubated at 37°C for 1hr ...
-
bioRxiv - Plant Biology 2024Quote: ... 1 unit of Taq DNA polymerase (GenScript). PCR was conducted at 94 °C for 3 min for denaturation followed by 35-40 cycles of 94 °C for 30 sec ...
-
bioRxiv - Biochemistry 2024Quote: ... 1 mg/mL 3X-FLAG peptide (Genscript). Final purification was achieved by size exclusion chromatography (SEC ...
-
bioRxiv - Immunology 2022Quote: Twenty 15-mer peptides (Figure 1A) used in human and mouse T-cell stimulation experiments were chemically synthesized by Genscript (TFA removal, >85% purity). The peptides were dissolved in DMSO at 20 mg/mL (∼12 mM) ...
-
bioRxiv - Microbiology 2022Quote: ... Immunizations were done on eight-to twelve-week-old H2L2 mice interperitoneally with 50-100 μg of a recombinant SARS-CoV2 Spike RBD319-591-Fc fusion protein generated from sequence from the original Wuhan seafood market pneumonia virus isolate (GenBank Accession# MN908947) and cloned in-frame into pcDNA vectors containing human IgG1 and mouse IgG2a Fc tags (GenScript USA Inc., Piscataway, NJ). Each mouse received a prime followed by 2 boosts ...
-
bioRxiv - Neuroscience 2021Quote: ... we used a custom rabbit polyclonal anti-mouse AQP4ex (a gift from Drs Frigeri and Nicchia) generated against the peptide DSTEGRRDSLDLASC within the mouse AQP4 carboxyl terminal extension (GenScript Biotech, Piscataway, NJ, USA) that has been shown to detect the extended AQP4 isoforms 21 ...
-
bioRxiv - Genetics 2023Quote: ... mutans cultures were diluted 1:40 from overnight cultures and grown to an optical density of OD600 ∼0.1 in THYE before the addition of transforming DNA and 1 μg ml−1 Competence Stimulating Peptide (CSP; GenScript). The cultures were subsequently incubated for an additional 2 h and then plated on antibiotic-supplemented THYE plates ...
-
bioRxiv - Biochemistry 2021Quote: ... Primary antibodies (anti-FLAG M2; Sigma and chimeric ACE2-Fc (Genscript; Z03484) were diluted in PBS-BSA to 1 μg mL−1 and added to each imaging dish ...
-
bioRxiv - Biochemistry 2021Quote: ... The soluble fraction was bound to anti-DYKDDDDK resin (Genscript, Piscataway, NJ) for 1 h at 4 °C ...
-
bioRxiv - Biophysics 2020Quote: ... and the supernatant was applied to anti-Flag M2 affinity resin (GenScript) by gravity ...
-
bioRxiv - Immunology 2021Quote: A monoclonal anti-SARS-CoV-2 RBD capture antibody (GenScript, Cat# 5B7D7) was coated on Nunc Maxisorp ELISA plates (Thermo Fisher Scientific ...
-
bioRxiv - Immunology 2021Quote: ... An anti-SARS-CoV-2 Spike monoclonal neutralizing antibody (GenScript, Cat# 6D11F2) was used as a positive control ...
-
A gut-secreted peptide controls arousability through modulation of dopaminergic neurons in the brainbioRxiv - Neuroscience 2020Quote: Rabbit anti-CCHa1 antibodies were raised against the peptide QIDADNENYSGYELT21 by Genscript and affinity purified by the company.
-
bioRxiv - Microbiology 2019Quote: ... discoideum crude extract with an anti-FLAG rabbit polyclonal antibody (GenScript, USA). For ectopic expression assays ...
-
bioRxiv - Genetics 2021Quote: ... Erg11 anti-peptide rabbit polyclonal antibody was produced by GenScript (Piscataway, NJ). The peptide sequence was AKIYWEKRHPEQKY ...
-
bioRxiv - Cell Biology 2020Quote: A custom rabbit anti-TbKH polyclonal antibody (pAb) was generated by GenScript, using their 49-day antibody generation protocol ...
-
bioRxiv - Immunology 2022Quote: ... Specific anti-SCV2 immunoreactivity was detected using a SCV2 nucleoprotein antibody (Genscript) at a 1:1000 dilution ...
-
bioRxiv - Molecular Biology 2023Quote: ... and a custom made anti-P2 gpV polyclonal antibody generated by GenScript. The secondary antibodies were both from Abcam ...
-
bioRxiv - Biochemistry 2022Quote: ... The primary antibody (rabbit anti-ScV-L-A peptide serum by GenScript) was diluted at 2:25000 in 2% (w/v ...
-
bioRxiv - Microbiology 2023Quote: ... 0.874 mg/mL anti-FimH polyclonal antibody (custom antibody produced by Genscript) or 0.96 mg/mL anti-Muc2 (Novus) ...
-
bioRxiv - Immunology 2023Quote: ... Specific anti-SCV2 immunoreactivity was detected using a SCV2 nucleoprotein antibody (Genscript) at a 1:1000 dilution ...
-
bioRxiv - Molecular Biology 2023Quote: ... and the supernatant was loaded onto anti-DYKDDDDK G1 affinity resin (GenScript) equilibrated in buffer A ...
-
bioRxiv - Immunology 2023Quote: ... and detected with MonoRab™ Rabbit Anti-Camelid VHH Cocktail [HRP] (Genscript), diluted 1:500 in blocking buffer.
-
bioRxiv - Biochemistry 2023Quote: ... the membranes were incubated with the relevant primary antibody anti-FnCpf1 (GenScript), anti-LbCpf1 (Millipore) ...
-
bioRxiv - Biochemistry 2024Quote: ... and supernatant was applied to incubate with anti-Flag affinity resin (Genscript) at 4 °C for 1.5 hours ...
-
bioRxiv - Biochemistry 2022Quote: The N-terminal peptides of ParBpSM (residues 1-27) and ParBP1 (residues 1-30) used in the ATPase assays were synthesized by GenScript. The sequence of ParBpSM1-27 and its variant ParBpSM1-27 K10A were NH2-MIVGNLGAQKAKRNDTPISAKKDIMGD-CO2H (≥97 % purity ...
-
bioRxiv - Molecular Biology 2022Quote: ... The coding sequences of human UBXN1 (Uniprot identifier Q04323-1) and FAF2 (Uniprot identifier Q96CS3-1) were synthesized by GenScript Biotech ...
-
bioRxiv - Immunology 2022Quote: ... et al (HPV16 E7) and Drakes et al (NY-ESO-1, 1G4 and MART-1, DMF5) were ordered from GenScript in the MSGV-retroviral vector (33 ...
-
bioRxiv - Developmental Biology 2022Quote: ... The blot was incubated with 10 μg/mL pre-biotin-CpOGACD for 1 h at room temperature followed by incubation with streptavidin-HRP (1:5000, M00091, GenScript) for 30 min.
-
bioRxiv - Cell Biology 2023Quote: ... residues 1-77) and human STX4 (lacking the transmembrane domain; residues 1-271 with 272C) were generated as synthetic genes (Genscript) with codon optimization for human expression ...
-
bioRxiv - Immunology 2023Quote: ... DNA encoding HLA-C*05:01 (1-278) and β2M (1-99) were synthesized and cloned into pET30a by Genscript and were previously described42 ...
-
bioRxiv - Immunology 2023Quote: Genes coding for SARS-CoV-2 Spike (S) ectodomains (Hu-1 and BA.1) with Hisx8 and Strep tags were synthesized by Genscript and cloned into the pcDNA3.1(+ ...
-
bioRxiv - Biophysics 2023Quote: The C-terminal 10mer peptides of nectin-1 and JAM-A (sequences in Supplementary Table 1) were purchased lyophilized from Genscript with N-terminal biotinylation and N-terminal FITC conjugation ...
-
bioRxiv - Microbiology 2023Quote: Genes encoding His-tagged ectodomain versions of the HSV-1 gD receptors HVEM (HVEM200t) or nectin-1 (nectin345t) were synthesized by GenScript (GenBank accession numbers AF060231 and U70321 ...
-
bioRxiv - Biochemistry 2020Quote: Glutathione S-Transferase (GST) (GenScript; Cat. # Z02039-1), ubiquitin (R&D Systems ...
-
bioRxiv - Microbiology 2019Quote: ... and incubated with 500 pM GLP-1 (GenScript) for 4 h at room temperature ...
-
bioRxiv - Immunology 2021Quote: ... and 1 mg/mL MOG35-55 peptide (Genscript). Mice were immunized on both flanks by subcutaneous injection of the emulsion for a total of 200 µL ...
-
bioRxiv - Bioengineering 2020Quote: ... and 1 mM RGD (Ac-RGDSPGERCG-NH2) (GenScript). The other solution contained an 8mM di-cysteine modified Matrix Metalloprotease (MMP ...
-
bioRxiv - Microbiology 2022Quote: ... THE V5 Tag Antibody (1:2000, GenScript Biotech) was used as primary antibody for samples and mouse anti-clathrin heavy chain clone 23 (1:2,000 ...