Labshake search
Citations for GenScript :
6001 - 6050 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2019Quote: ... Rabbit (Genscript, #A00174) in Blocking Solution for 60 min at room temperature ...
-
bioRxiv - Molecular Biology 2019Quote: Samples were run on either 4-20% Express Plus PAGEs in Tris-MOPS-SDS running buffer (GenScript), 10% Criterion TGX gels (BioRad ...
-
bioRxiv - Molecular Biology 2019Quote: ... The TSEN34 (Y247A, H255A, K286A) and TSEN2 (Y369A, H377A, K416A) catalytic mutant co-expression plasmid was generated by Genscript. Please refer to Table S1 for a list of all expression plasmids used in this study ...
-
bioRxiv - Molecular Biology 2019Quote: ... Plasmid pHis1522 encoding his-tagged TcsL was synthesized and codon optimized for Bacillus megaterium (Genscript). To express and isolate recombinant TcsL ...
-
bioRxiv - Biophysics 2019Quote: ... The supernatant was incubated with anti-Flag G1 affinity resin (Genscript) at 4 °C for 2 h and then washed with 30 bed volumes of lysis buffer added 0.05% GDN (Anatrace) ...
-
bioRxiv - Biophysics 2019Quote: ... The protein was eluted with lysis buffer added 0.05% GDN and 300 μg ml-1 Flag peptide (Genscript). The protein solution was concentrated with a 100-kDa cut-off centricon (Milipore ...
-
bioRxiv - Molecular Biology 2019Quote: ... Cells were arrested in G1 by addition of 10 µg/ml alpha factor peptide (Genscript) for 1.5 hrs ...
-
bioRxiv - Molecular Biology 2019Quote: The NS1 sequence from ZIKV (Mexican isolate, Asiatic linkage) and YFV NS1 (Brazilian yellow fever virus isolate) were synthesized de novo (GenScript, Piscataway, NJ). The synthetic ZIKV NS1 gene (GenBank accession number KY631493.1 ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... 1 μg of POR-WT and mutant membrane proteins were separated on an SDS-PAGE gel and blotted on to polyvinyl difluoride (PVDF) membranes to probe with a rabbit polyclonal antibody against wild-type human POR from Genscript (Genscript, NJ, USA) as described previously [43] ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... membranes to probe with a rabbit polyclonal antibody against wild-type human POR from Genscript (Genscript, NJ, USA) as described previously [43] ...
-
bioRxiv - Molecular Biology 2019Quote: ... Cells were transiently transfected with a pcDNA3.1 vector that expressed a C-terminally Flag-tagged AFG3L2 (GenScript) with the indicated single-point mutations ...
-
bioRxiv - Biochemistry 2019Quote: ... C5appep was synthesized from Genscript. HEK-293 cells (ATCC ...
-
bioRxiv - Biochemistry 2019Quote: ... synthesized and cloned into pUC57 by GenScript, and then sub-cloned into the pHUE vector [14] between BamHI and HindIII sites to yield pHUE-SbtB7001 ...
-
bioRxiv - Plant Biology 2019Quote: ... SlMai1-myc or synSlMai1-myc proteins were detected using anti-Myc antibodies (GenScript; A00704) and chemilumiscent ECL Plus substrate (Thermo Fisher Scientific) ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... Angiotensin II and SII (Sar1, Ile4,8]-Angiotensin II) 39 were obtained from Genscript (Piscataway, NJ) and MyBioSource (San Diego ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... and TRV120055 46 were synthesized by Genscript. For clarity ...
-
bioRxiv - Biochemistry 2019Quote: ... cerevisiae Asc1p was subcloned from a cloned cDNA construct purchased from Genscript (ORF clone OSi04112D). At the 3’ end of each construct was sequence encoding for the ybbR peptide tag and a stop codon (GATTCTCTTGAATTTATTGCTAGTAAGCTTGCGTAG) ...
-
bioRxiv - Microbiology 2019Quote: ... Primer synthesis and the sequencing of PCR products or plasmids were performed by Genscript Biotech (Nanjing ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... Blots were first incubated with a rabbit polyclonal antibody against wild-type human POR from Genscript (Genscript, NJ, USA) at a dilution of 1:1000 ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... Blots were first incubated with a rabbit polyclonal antibody against wild-type human POR from Genscript (Genscript, NJ, USA) at a dilution of 1:1000 ...
-
bioRxiv - Microbiology 2019Quote: ... a 2245 bp fragment containing the fused left and right flanks of the MSMEG_0746 gene was synthesized by GenScript. This fragment was cloned into the SpeI site of the mycobacterial shuttle plasmid pX33 [68] with E ...
-
bioRxiv - Molecular Biology 2019Quote: ... -voltage-dependent anion-selective channel 1 (VDAC1, Genscript, cat # A01419), -succinate dehydrogenase complex ...
-
bioRxiv - Biochemistry 2019Quote: ... oligomer and aggregate were prepared by our previously reported methods.17 Acetylated-K16 Aβ1-40 was purchased from GenScript. Purified anti-β-Amyloid 1-16 (clone 6E10) ...
-
bioRxiv - Molecular Biology 2019Quote: ... The 8 kb p5343 was synthesized by Genscript (Piscataway, NJ). To propagate the synthesized DNA in the model bacterium E ...
-
bioRxiv - Developmental Biology 2019Quote: ... All iOn and control piggyBac vectors were assembled in a pUC57-mini plasmid backbone (Genscript Inc) using a combination of DNA synthesis (Genscript Inc) ...
-
bioRxiv - Developmental Biology 2019Quote: ... using a combination of DNA synthesis (Genscript Inc), Gibson assembly (NEB ...
-
bioRxiv - Microbiology 2019Quote: ... was generated with a GenParts™ DNA Fragment (GenScript) containing NSP5 ORF lacking the amino acids 80-130 (VKTNADAGVSMDSSAQSRPSSNVGCDQVDFSLNKG LKVKANLDSSISIST ...
-
bioRxiv - Neuroscience 2019Quote: ... The QuasAr3-PP-Citrine-Kv2.1-ER2 gene was synthesized de novo (GenScript Biotech Corp.) based on sequences reported in the original preprint22 ...
-
bioRxiv - Immunology 2019Quote: ... KHNYN-2 (NM_001290256) was synthesized by GenScript. KHNYN-1 was cloned by amplifying the nucleotides 123-2157 from KHNYN-2 and sub-cloning the PCR product into the pcDNA3.1 (+ ...
-
bioRxiv - Microbiology 2019Quote: Pure peptides (≥95% purity) were synthesized on resin using solid phase Fmoc peptide chemistry39 by GenScript Inc ...
-
bioRxiv - Genetics 2019Quote: ... and Myc-PA36 were subcloned (Genscript, Inc.) into pACU2 vectors (from Chun Han ...
-
bioRxiv - Biochemistry 2019Quote: ... synthesized (GenScript, Sigma) or were gifted (FUS-IDR plasmid was a gift from Cliff Brangwynne).
-
bioRxiv - Pharmacology and Toxicology 2019Quote: The sequences containing 7F9-Fc cDNA were custom synthesized and ligated into pUC57 (GenScript). Plasmids containing 7F9-Fc were transformed into Invitrogen Top10F competent cells (Thermo #C303003 ...
-
bioRxiv - Microbiology 2019Quote: ... we used a synthetic DNA fragment (Genscript) of 712 bp in length termed p6122 ...
-
bioRxiv - Biochemistry 2019Quote: ... coli by Genscript Corporation ...
-
bioRxiv - Bioengineering 2019Quote: ... the cross-linker solution was prepared by dissolving the di-thiol matrix metalloproteinase (MMP) sensitive peptide (Ac-GCRDGPQGIWGQDRCG-NH2, Genscript) in distilled water at 7.8 mM and reacted with 10 μM Alexa-Fluor 647-maleimide (Life-Technologies ...
-
Werner syndrome helicase is a selective vulnerability of microsatellite instability high tumor cellsbioRxiv - Cancer Biology 2019Quote: ... pLVX-WRN-3xFLAG-IRES-Puro E84A and pLVX-WRN-3xFLAG-IRES-Puro E84A _K577M for siRNA-resistant transgene expression were generated by gene synthesis (GenScript, China) based on the WRN cDNA sequence NCBI NM_000553.5 followed by cloning into the parental pLVX vector (Clontech ...
-
bioRxiv - Biochemistry 2019Quote: ... and boundary region peptides were purchased from Genscript. The N-terminal residue of all but the distal peptide was formylated ...
-
bioRxiv - Biophysics 2019Quote: ... and InfC-E166C were acquired commercially (GenScript, USA). Competent E ...
-
bioRxiv - Microbiology 2019Quote: ... was purchased from GenScript. The length of the ORFs was checked by PCR (Fig ...
-
bioRxiv - Cell Biology 2019Quote: Fmoc-protected amino-acids were from GenScript USA Inc ...
-
bioRxiv - Microbiology 2019Quote: ... Wild-type MreB and a series of amber codon mutants (Table S1) were synthesized by Genscript (Piscataway, NJ) and used to replace the IPTG-inducible YFP to create a plasmid encoding Plac-MreB and Para-AiMB (pMreBXL1-26) ...
-
bioRxiv - Genetics 2019Quote: ... The plasmid was synthesized by GenScript. We also designed the piggyBac vector containing tetR-3xFlag-HA and obtained the plasmid synthesized by GenScript ...
-
bioRxiv - Genetics 2019Quote: ... We also designed the piggyBac vector containing tetR-3xFlag-HA and obtained the plasmid synthesized by GenScript. We transfected the plasmids with Super PiggyBac Transposase Expression Vector (System Biosciences ...
-
bioRxiv - Cell Biology 2019Quote: Protease-activated receptor 1 (PAR-1)-activating peptide (TFLLRNPNDK-NH2) was custom synthesized as the C-terminal amide with a purity of > 95% by Genscript (Piscataway, NJ). Scrambled-siRNA (Sc-siRNA ...
-
bioRxiv - Cell Biology 2019Quote: ... 5’-AATTCGGTCATGCCAGCGTA-3’) to target the mFoxO1gene and scrambled sgRNA (Sc-sgRNA) (5’-GCGAGGTATTCGGCTCCGCG-3’) were custom made by Genscript (Piscataway, NJ).
-
bioRxiv - Biochemistry 2019Quote: Synthetic genes were ordered from Genscript Inc ...
-
bioRxiv - Biophysics 2019Quote: All peptides were synthesized as ordered by Genscript with N-terminal acetylation and C-terminal amidation modifications ...
-
LIR-dependent LMX1A/LMX1B autophagy crosstalk shapes human midbrain dopaminergic neuronal resiliencebioRxiv - Cell Biology 2019Quote: ... LMX1B-FLAG in pcDNA3.1 (Genscript), or pLVX-puro plasmids were used ...
-
bioRxiv - Microbiology 2019Quote: ... and actin (Genscript, A00730-200) antibodies were diluted to 1:1000 in TBST 5% BSA and incubated overnight at 4°C following by the same procedure as describe previously.