Labshake search
Citations for Takara Bio :
351 - 400 of 830 citations for SARS CoV 2 Spike Glycoprotein S1 RBD His Tag CHO since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: ... Donor vectors containing the GFP or mKate2 coding sequence flanked by 1kb homology arms adopted from both 3′ and 5′ sides of the insertion site were generated by cloning of PCR-amplified tags and arms into linearized pGEM-3z vector by In-Fusion HD Cloning Kit (Takara Bio). Obtained gRNA expression plasmids and donor plasmids were injected into the y w embryos with a final concentration of 120 ng/ul for each ...
-
bioRxiv - Cell Biology 2022Quote: ... ACLY lentivirus constructs were generated by inserting ACLY variants with an N-terminal MYC tag into pLVX-IRES-Puro (Clontech, 632183). All DNA constructs were verified by Sanger sequencing.
-
bioRxiv - Immunology 2022Quote: ... and the transmembrane domain replaced with a GCN448 or foldon trimerization49 domain followed by an Avi-Tag50 and a hexahistidine tag was cloned into a mammalian expression vector (pADD2) by In-Fusion (Takara Bio). Similarly ...
-
bioRxiv - Microbiology 2023Quote: ... the V5-tag sequence followed by a Stop codon was introduced upstream of the IRES in the pLVX-IRES-Neo vector (Clontech, Addgene), using annealed oligo-cloning ...
-
bioRxiv - Biochemistry 2023Quote: ... 425 – 658) and SipAC-Core (a.a. 512 – 658) were cloned with an N-terminal 6xHis-tag into pColdI vector (Takara Bio USA) modified to include a tobacco etch virus (TEV ...
-
bioRxiv - Biochemistry 2024Quote: ... The recombinant SMC1A HD/RAD21C and SMC3 HD/RAD21N protein complexes were then purified by affinity chromatography using the 10xHis purification tag on RAD21 by incubating the cleared lysates with TALON Metal Affinity Resin (Takara Bio). The purification tag was then removed on the affinity beads by overnight 3C protease digestion at 4°C ...
-
bioRxiv - Microbiology 2021Quote: ... at 30°C for 3-5 days and assayed for growth on the SD/-Trp/-Leu/-His/-Ade/X-α-gal plates (TaKaRa Bio). Each experiment was repeated at least three times.
-
bioRxiv - Neuroscience 2022Quote: ... double-stranded cDNA whole transcriptome library was synthesized from 1µg of total RNA with Takara Bio’s SMARTer Stranded Total RNA Sample Prep Kit – HI Mammalian (Takara Bio, Cat. No. 634876) and SMARTer RNA Unique Dual Index Kit (Takara Bio ...
-
bioRxiv - Neuroscience 2020Quote: ... this was followed by a second screening using the SD quadruple dropout (Leu−, Trp−, Ade−, and His−) selective medium (Clontech Takara Bio). After the elimination of duplicates containing the same AD/library plasmid via yeast-colony PCR ...
-
bioRxiv - Plant Biology 2020Quote: ... and LacZ reporter genes was examined with yeast AH109 transformants on SD/−Trp/−His and SD/−Trp/−Ade media (Clontech Inc., USA). The fix composition of SD plates contained 0.17 g yeast nitrogen base (YNB) ...
-
bioRxiv - Plant Biology 2023Quote: ... and on a SD-Leu-Trp-Ade-His plate containing X-α-gal and supplemented with 0.2 µg/ml Aureobasidin A (Takara Bio, USA). Plates were imaged after incubation for 60–72 hr at 30 °C ...
-
bioRxiv - Microbiology 2020Quote: ... The PCR product was then cloned into the BG1861 vector by ligation-independent cloning to introduce a N-terminal 6xHis tag and transformed into Stellar™ chemically competent cells (Clontech Laboratories) for plasmid propagation (84) ...
-
bioRxiv - Biochemistry 2022Quote: ... using SARS-CoV-2 S as template and subcloned into pcDNA3.3 vector with a C-terminal hexahistidine tag using In-Fusion cloning technology (Takara Bio USA, Inc.). RBD of SARS-CoV S was cloned into pcDNA3.3 vector from pcDNA3.1-SARS-Spike (Addgene plasmid#145031) ...
-
bioRxiv - Plant Biology 2022Quote: ... The PCR fragment containing the SHHc tag was combined with the digested backbone using In-Fusion HD cloning (Clontech, Mountain View, California) to make pK7-SHHc ...
-
bioRxiv - Immunology 2023Quote: ... Genomic DNA samples from the patients’s paired tumor tissues and WBCs were used to prepare DNA libraries for DNA sequencing with the ThruPLEX Tag-seq Kit (Takara Bio, USA). The libraries were then pooled and hybridized with pre-designed probes for 95 targeted genes (Integrated DNA Technologies ...
-
bioRxiv - Cancer Biology 2023Quote: ... Genomic DNA samples from the patients’s paired tumor tissues and WBCs were used to prepare DNA libraries for DNA sequencing with the ThruPLEX Tag-seq Kit (Takara Bio, USA). The libraries were then pooled and hybridized with pre-designed probes for 95 targeted genes (Integrated DNA Technologies ...
-
bioRxiv - Developmental Biology 2024Quote: ... the C-terminal twin strep tag was removed by incubating with the 3C protease (Takara Bio, Japan; 1.5 unit/50 mg protein) and ran on a size-exclusion column ...
-
bioRxiv - Developmental Biology 2019Quote: ... 2 mM dithiothreitol (Clontech), 2 μM template switching oligo (Exiqon) ...
-
bioRxiv - Molecular Biology 2024Quote: ... 2 (Takara, Shiga, Japan) and 0.32 µM of each primer according to the manufacturer’s instructions ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Synthetic Biology 2020Quote: Yeast with the uracil auxotrophy were cultivated in complete synthetic media without uracil prepared with -His-Ura dropout supplement (Clontech, Mountain View, CA) according to manufacturer’s instructions and supplemented with 20 g/mL histidine and 80mg/L adenine hemisulfate (Sigma-Aldrich ...
-
bioRxiv - Biophysics 2019Quote: ... cells bearing the corresponding plasmids and were purified according to.63 Partially purified lysates were loaded onto equilibrated cobalt His-TALON columns (Clontech, Mountain View, CA). The column was washed with 40 to 50 volumes of wash buffer (50 mM NaH2PO4 ...
-
bioRxiv - Plant Biology 2022Quote: ... and impact of SAID1/SAID2 on SE interaction with other proteins was examined on SD-His/-Leu/-Met/-Trp quadruple dropout medium (Clontech, Cat. No. 630429) supplemented with 5 mM 3-amino-1,2,4-triazole (3-AT ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid described previously (9) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987). Briefly ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid (Quadri et al., 2018) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987) via Gibson Assembly® (NEB ...
-
bioRxiv - Microbiology 2020Quote: For Bioluminescence Resonance Energy Transfer (BRET) assay we used the pEYFP-C1/N1 plasmids encompassing EYFP tag in the N- or C-terminal positions (Clontech, Mountain View, CA). To obtain pNluc-C1/N1 plasmids ...
-
bioRxiv - Immunology 2021Quote: ... or RARα403 (RARα-dAF2) 41 with a C-terminal Halo-tag were generated using the In- Fusion Cloning Kit (TaKaRa Bio Inc, Shiga, Japan). Lentiviruses were generated using CSII-EF- MCS-IRES2-Venus (for overexpression) ...
-
bioRxiv - Biochemistry 2021Quote: ... vector (including the N-terminal hexahistidine and thrombin tags) by In-Fusion cloning using the In-Fusion HD Cloning Kit (Takara Bio, Kusatsu, Japan), yielding the pBAD-yTrm5 vector ...
-
bioRxiv - Microbiology 2023Quote: ... or the BamHI/MluI site of pWPI-ACE2-zeo (for ACE2 expression plasmids)43 with 3×FLAG-tag at the C-terminus using In-Fusion® HD Cloning Kit (Takara, Cat# Z9650N). Nucleotide sequences were determined by DNA sequencing services (Eurofins) ...
-
bioRxiv - Cell Biology 2024Quote: ... A bicistronic construct expressing human EPAC1b with a C-terminal His10 tag and SUMO3(Q89K) was constructed using the pIRES2-EGFP vector (Clontech Catalog no. 632435). The EPAC1-His10-IRES-SUMO3(Q89K ...
-
bioRxiv - Biochemistry 2024Quote: ... and XcSGL (KEGG locus tag, XCC2207) were amplified by PCR chain reaction using KOD plus (TOYOBO, Osaka, Japan) or PrimeSTAR Max (Takara Bio, Shiga, Japan) for the DNA polymerase and the primer pairs ...
-
bioRxiv - Developmental Biology 2019Quote: ... Positive blue colonies were streaked to an -Ade-His-Leu-Trp dropout selective media agar plates supplemented with Aureoblastidin A and X-gal (Clontech yeast two-hybrid manual).
-
bioRxiv - Immunology 2023Quote: ... The 6-His tagged recombinant proteins were purified from the supernatant by gravity-fed through TALON® Metal Affinity Resin (Takara Bio, Shiga, Japan). Following a wash step with PBS (pH 8) ...
-
bioRxiv - Neuroscience 2019Quote: ... A SARM1-GFP expression vector consisting of the entire coding region of murine SARM1 cloned (by PCR) into pEFGP-N1 (Clontech, C-terminal eGFP tag) was used for re-expression of SARM1 in Nmnat2gtE/gtE;Sarm1−/− neurons ...
-
bioRxiv - Microbiology 2021Quote: ... The codon-optimized cDNAs of the open reading frame of the human or animal ACE2 gene with FLAG tag were synthesized by Integrated DNA Technologies (Coralville, IA) and cloned into pIRES-Neo3 (Takara Bio, Mountain View, CA). For the ACE2 gene of white-tailed deer ...
-
bioRxiv - Synthetic Biology 2020Quote: ... dry milk and 0.1 % (v/v) Tween 20 and then incubated with mouse anti-6xHis tag monoclonal antibody-HRP conjugate (Clontech or Thermo Fisher Scientific, USA) in the same buffer for 2 h at room temperature ...
-
bioRxiv - Immunology 2020Quote: ... Then subsequent primary antibody incubation was done overnight at 4 degrees (all primary antibodies were diluted in 1% blocking milk or for Phos-tag with MBL Max blot solution 1 or Takara Western blot immune booster). Proteins of interest were detected with Anti-Rabbit IgG HRP (Cell signaling technologies ...
-
bioRxiv - Neuroscience 2023Quote: ... with a HA tag and deletion mutants of Lag3 D1 domain with a myc tag were constructed by PCR with In-Fusion HD Cloning Plus systems (Takara; Bio Inc., Otsu, Japan) using the CloneAmp™ HiFi PCR Premix (a high-fidelity PCR polymerase included with all In-Fusion HD Cloning Plus Systems) ...
-
bioRxiv - Cancer Biology 2023Quote: ... cDNA sequences of PAK1 mutants with a C-terminus Flag tag were synthesized at BGI Genomics (Beijing, China) then cloned into pLVX-IRES-Neo vector (632184; Takara Bio, Kusatsu, Shiga, Japan). All sequences are in Extended Data Table 2.
-
bioRxiv - Neuroscience 2022Quote: ... Doxycycline (2 mg/L, Clontech) was also included on d0 to induce TetO gene expression by binding to rtTA and the TetO promoter upstream of the Ngn2 gene ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 µg/ml doxycycline (Takara) was added on day 0 to induce TetO gene expression ...
-
bioRxiv - Cell Biology 2024Quote: ... Ver.2 (Takara, cat# 6233), as per manufacturer’s protocol.
-
bioRxiv - Immunology 2024Quote: ... The full-length CD177 cDNA inserts were sub-cloned into pBMN-I-EGFP retroviral vector digested with Bam HI and EcoR I restriction enzymes using InFusion HD Cloning Kit (Takara Bio USA, Mountain View, Ca) according to the product manual ...
-
bioRxiv - Molecular Biology 2019Quote: ... 2 (TaKaRa bio. Inc., Shiga, Japan). The vector was transformed into XL1-Blue Escherichia coli competent cells (GMbiolab Co. ...
-
bioRxiv - Molecular Biology 2019Quote: ... 2 (Dye Plus; TaKaRa, Dalian, Japan), according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2020Quote: ... Lenti-X concentrator (PT4421-2, Clontech) was mixed at the ratio of 1:3 and incubated at 4 °C for a short time ...
-
bioRxiv - Cell Biology 2021Quote: ... and doxycycline (2 mg/ml, Clontech). After 6 hours ...
-
bioRxiv - Developmental Biology 2022Quote: ... 2 mM DTT (Takara Bio, #639537), 1 mM dNTPs (Takara Bio ...
-
bioRxiv - Cell Biology 2021Quote: ... containing doxycycline (2 mg/ml, Clontech). We kept the cells in this medium for 5 days ...
-
bioRxiv - Biochemistry 2023Quote: ... 2 Units of Exonuclease III (Takara) were added to 1ug of NCPs in ExoIII digestion buffer (50 mM Tris– HCl (pH 8.0) ...