Labshake search
Citations for Takara Bio :
401 - 450 of 980 citations for Recombinant Mouse PPAR gamma Protein His tag since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2024Quote: ... the sequence encoding the N-terminal Avi-tag was removed from the expression plasmid using In-Fusion® cloning (Takara #638948) prior to protein expression and purification ...
-
bioRxiv - Microbiology 2021Quote: ... at 30°C for 3-5 days and assayed for growth on the SD/-Trp/-Leu/-His/-Ade/X-α-gal plates (TaKaRa Bio). Each experiment was repeated at least three times.
-
bioRxiv - Neuroscience 2022Quote: ... double-stranded cDNA whole transcriptome library was synthesized from 1µg of total RNA with Takara Bio’s SMARTer Stranded Total RNA Sample Prep Kit – HI Mammalian (Takara Bio, Cat. No. 634876) and SMARTer RNA Unique Dual Index Kit (Takara Bio ...
-
bioRxiv - Neuroscience 2020Quote: ... this was followed by a second screening using the SD quadruple dropout (Leu−, Trp−, Ade−, and His−) selective medium (Clontech Takara Bio). After the elimination of duplicates containing the same AD/library plasmid via yeast-colony PCR ...
-
bioRxiv - Plant Biology 2020Quote: ... and LacZ reporter genes was examined with yeast AH109 transformants on SD/−Trp/−His and SD/−Trp/−Ade media (Clontech Inc., USA). The fix composition of SD plates contained 0.17 g yeast nitrogen base (YNB) ...
-
bioRxiv - Plant Biology 2023Quote: ... and on a SD-Leu-Trp-Ade-His plate containing X-α-gal and supplemented with 0.2 µg/ml Aureobasidin A (Takara Bio, USA). Plates were imaged after incubation for 60–72 hr at 30 °C ...
-
bioRxiv - Neuroscience 2024Quote: The samples were rRNA depleted and prepared for sequencing using SMARTer Stranded Total RNA Sample Prep Kit - HI Mammalian (Takara Bio, France). In brief ...
-
bioRxiv - Synthetic Biology 2024Quote: Long range PCR of the full synthetic HIS module was set up in a 25 μL of LA Taq Hot Start (TaKaRa, Shiga Japan) PCR reaction according to the manufacturers’ protocol ...
-
bioRxiv - Plant Biology 2021Quote: ... The fused proteins were purified with the GST-tagged protein purification kit (Clontech, USA) according to the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2020Quote: ... Proteins were tagged with Gfp (enhanced green fluorescent protein; Clontech, Mountain View, CA, USA) at their N-terminus unless noted otherwise ...
-
bioRxiv - Cancer Biology 2022Quote: ... The protein concentration was determined using the BCA protein assay kit (TaKaRa, Shiga, Japan) according to the manufacturer’s instructions ...
-
bioRxiv - Developmental Biology 2023Quote: ... The protein concentration was quantified using the TaKaRa BCA Protein Assay Kit (TaKaRa, Japan), and 2-mercaptoethanol (Nacalai Tesque ...
-
bioRxiv - Plant Biology 2024Quote: ... Total protein concentration was determined with a Bradford Protein Assay Kit (Takara Bio Inc.) according to the microtiter plate protocol recommended by the manufacturer ...
-
bioRxiv - Microbiology 2024Quote: ... Protein concentrations were measured using the TaKaRa Bradford Protein Assay Kit (TaKaRa, Cat# T9310A). Then ...
-
bioRxiv - Microbiology 2020Quote: ... The PCR product was then cloned into the BG1861 vector by ligation-independent cloning to introduce a N-terminal 6xHis tag and transformed into Stellar™ chemically competent cells (Clontech Laboratories) for plasmid propagation (84) ...
-
bioRxiv - Biochemistry 2022Quote: ... using SARS-CoV-2 S as template and subcloned into pcDNA3.3 vector with a C-terminal hexahistidine tag using In-Fusion cloning technology (Takara Bio USA, Inc.). RBD of SARS-CoV S was cloned into pcDNA3.3 vector from pcDNA3.1-SARS-Spike (Addgene plasmid#145031) ...
-
bioRxiv - Plant Biology 2022Quote: ... The PCR fragment containing the SHHc tag was combined with the digested backbone using In-Fusion HD cloning (Clontech, Mountain View, California) to make pK7-SHHc ...
-
bioRxiv - Immunology 2023Quote: ... Genomic DNA samples from the patients’s paired tumor tissues and WBCs were used to prepare DNA libraries for DNA sequencing with the ThruPLEX Tag-seq Kit (Takara Bio, USA). The libraries were then pooled and hybridized with pre-designed probes for 95 targeted genes (Integrated DNA Technologies ...
-
bioRxiv - Cancer Biology 2024Quote: ... Genomic DNA samples from the patients’s paired tumor tissues and WBCs were used to prepare DNA libraries for DNA sequencing with the ThruPLEX Tag-seq Kit (Takara Bio, USA). The libraries were then pooled and hybridized with pre-designed probes for 95 targeted genes (Integrated DNA Technologies ...
-
bioRxiv - Neuroscience 2024Quote: ... the N-terminal fragment containing the endogenous signaling peptide upstream the HA tag and the InFusion sequence optimized for InFusion cloning (Takara Bio #638909) was synthetically generated by IDT (TACGACTCACTATAGGCTAGCGCCACCATGGATGCCCGCACCTGGCGTCTGGGCTGGCG CTGTCTCCTTCTCCTGGCTCTCCTTGGATCTACCCGAAGCTATCCGTATGATGTTCCGGAT TATGCAGAGGGCGTGG) ...
-
bioRxiv - Neuroscience 2020Quote: ... each well of the lysis plates contained 0.4 μL lysis buffer [0.5 U Recombinant RNase Inhibitor (Takara Bio, 2313B), 0.0625% Triton X-100 (Sigma ...
-
bioRxiv - Microbiology 2022Quote: The recombinant pGBKT7-TaPHB-1 was transformed into Y2HGold yeast strain following the Yeastmaker Yeast Transformation System 2 (TaKaRa). The transformants were screened on SD/-Trp agar plate ...
-
bioRxiv - Cancer Biology 2022Quote: ... the recombinant pAAV-CRE plasmid was packaged in HEK293T cells using pHelper and pRC2-mi342 plasmids (Takara, Catalog #632608). Cells were harvested three days after transfection and AAV2 was isolated using AAVpro Extraction Solution (Takara ...
-
bioRxiv - Immunology 2022Quote: ... Recombinant adenovirus vaccines were produced using the Adeno-X™ Adenoviral System 3 according to the manufacturer’s manual (Takara Korea Biomedical Inc. ...
-
bioRxiv - Microbiology 2022Quote: ... The recombinant adenovirus was prepared in HEK293 cells and purified with an Adeno-X Virus Purification kit (Takara Bio). The purified virus titer was determined using an Adeno-X Rapid Titer kit (Takara Bio) ...
-
bioRxiv - Genomics 2023Quote: ... The recombinant pAAV-CRE plasmid was packaged in HEK293T cells using pHelper and pRC2-mi342 plasmids (Takara, Catalog #632608). Cells were harvested three days after transfection and AAV2 was isolated using AAVpro Extraction Solution (Takara ...
-
bioRxiv - Neuroscience 2024Quote: ... RNA was annealed to an oligo-dT primer (5’-AAGCAGTGGTATCAACGCAGAGTACT30VN-3’, IDT) in a buffer containing 2.5 mM dNTPs and recombinant RNase Inhibitor (Takara). First-strand synthesis was performed with the SuperScriptII kit using a custom template-switching oligo (5’-/5Me-isodC//iisodG//iMe-isodC/AAGCAGTGGTATCAACGCAGAGTACATrGrGrG-3’ ...
-
bioRxiv - Developmental Biology 2024Quote: ... resuspended in storage buffer (1% BSA in PBS, with 10% DMSO and 1U/µl recombinant RNAse inhibitor, Takara Bio) and stored at −20° C for further processing.
-
bioRxiv - Molecular Biology 2024Quote: Recombinant AAV vector was produced using a protocol previously described.36 AAVpro 293T cells (Cat. No. 632273, Takara Bio) were transfected with AAV plasmid carrying the AntagoNAT sequence ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Synthetic Biology 2020Quote: Yeast with the uracil auxotrophy were cultivated in complete synthetic media without uracil prepared with -His-Ura dropout supplement (Clontech, Mountain View, CA) according to manufacturer’s instructions and supplemented with 20 g/mL histidine and 80mg/L adenine hemisulfate (Sigma-Aldrich ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid described previously (9) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987). Briefly ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid (Quadri et al., 2018) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987) via Gibson Assembly® (NEB ...
-
bioRxiv - Plant Biology 2024Quote: ... The dilutions were plated on selective -LT medium as a growth control and on -LTH medium (7.6 g/L Yeast Nitrogen Base [YNB], 20 g/L glucose, 0.62 g/L DO supplement -leu -trp -his [Clontech], 15 g/L agar) for the protein interaction assay ...
-
bioRxiv - Cell Biology 2022Quote: ... Total protein was quantified using the TAKARA BCA Protein Assay Kit (TAKARA Bio Inc., Japan). Equal amounts of protein were separated by SDS-PAGE on 10% gels ...
-
bioRxiv - Immunology 2024Quote: ... Protein concentrations in each extract were quantified using Takara BCA Protein Assay Kit (Takara Bio). EMSA was performed using Gelshift™ Chemiluminescent EMSA (Active Motif ...
-
bioRxiv - Molecular Biology 2020Quote: ... mouse anti-His6 (Clontech, 631212). Anti-Flag beads were purchased from SIGMA.
-
bioRxiv - Evolutionary Biology 2020Quote: ... mouse anti-mCherry (Clontech, 632543) 1:200 ...
-
bioRxiv - Biochemistry 2021Quote: ... mouse anti-GFP (Clontech, 632381), 1:10,000 ...
-
bioRxiv - Neuroscience 2022Quote: ... and mouse-STEM101 (Takara Bio). Imaging was performed using Zeiss LSM880 or LSM900 confocal microscopes ...
-
bioRxiv - Cell Biology 2024Quote: ... total mouse liver mRNA (Takara) was used.
-
bioRxiv - Developmental Biology 2023Quote: ... mouse anti-mCherry (Clontech, 632543) at 1:450 ...
-
bioRxiv - Molecular Biology 2023Quote: ... Mouse fibroblast NIH-3T3 (Takara), human retinal pigment epithelial cells (hTERT-RPE1 or RPE1 ...
-
bioRxiv - Microbiology 2020Quote: For Bioluminescence Resonance Energy Transfer (BRET) assay we used the pEYFP-C1/N1 plasmids encompassing EYFP tag in the N- or C-terminal positions (Clontech, Mountain View, CA). To obtain pNluc-C1/N1 plasmids ...
-
bioRxiv - Immunology 2021Quote: ... or RARα403 (RARα-dAF2) 41 with a C-terminal Halo-tag were generated using the In- Fusion Cloning Kit (TaKaRa Bio Inc, Shiga, Japan). Lentiviruses were generated using CSII-EF- MCS-IRES2-Venus (for overexpression) ...
-
bioRxiv - Biochemistry 2021Quote: ... vector (including the N-terminal hexahistidine and thrombin tags) by In-Fusion cloning using the In-Fusion HD Cloning Kit (Takara Bio, Kusatsu, Japan), yielding the pBAD-yTrm5 vector ...
-
bioRxiv - Cell Biology 2024Quote: ... A bicistronic construct expressing human EPAC1b with a C-terminal His10 tag and SUMO3(Q89K) was constructed using the pIRES2-EGFP vector (Clontech Catalog no. 632435). The EPAC1-His10-IRES-SUMO3(Q89K ...
-
bioRxiv - Microbiology 2023Quote: ... or the BamHI/MluI site of pWPI-ACE2-zeo (for ACE2 expression plasmids)43 with 3×FLAG-tag at the C-terminus using In-Fusion® HD Cloning Kit (Takara, Cat# Z9650N). Nucleotide sequences were determined by DNA sequencing services (Eurofins) ...
-
bioRxiv - Biochemistry 2024Quote: ... The plasmid for GFP-β-actin expression was modified as a cDNA-encoding fluorescent tag of YFP-β-actin (TaKaRa-Clontech, Shiga, Japan) was substituted into that encoding eGFP (peGFP-actin).
-
bioRxiv - Biochemistry 2024Quote: ... The plasmid for GFP-β-actin expression was modified as a cDNA-encoding fluorescent tag of YFP-β-actin (TaKaRa-Clontech, Shiga, Japan) was substituted into that encoding eGFP (peGFP-actin).