Labshake search
Citations for Takara Bio :
1601 - 1650 of 2338 citations for 7 nitro 3 oxido 6 4 phenylpiperazin 1 yl 2 1 3 benzoxadiazol 3 ium since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2021Quote: ... Reverse transcription was carried out with 1 μg RNA using TB Green Premix Ex Taq™ II (Takara, Japan). Targets of around 110 bp were amplified with primers qtaxB-F/R ...
-
Panacea: a hyperpromiscuous antitoxin protein domain for the neutralisation of diverse toxin domainsbioRxiv - Microbiology 2021Quote: ... Filtered lysate was incubated with 1 mL of previously buffer equilibrated Ni-beads (His60 Ni Superflow Resin, TaKaRa, Japan) for 30 minutes ...
-
bioRxiv - Cell Biology 2021Quote: ... Total RNA (1 μg) was converted to cDNA using the PrimeScript™ RT reagent Kit with gDNA Eraser (TAKARA). Quantitative PCR (qPCR ...
-
bioRxiv - Biochemistry 2022Quote: ... Cells were washed twice with 20 mL of D-PBS (Nacalai Tesque) and resuspended in CELLBANKER 1 (Takara Bio) at 1 × 107 cells/mL ...
-
bioRxiv - Microbiology 2022Quote: ... The cDNA was prepared from 1 μg of total RNA using PrimeScript 1st strand cDNA Synthesis Kit (TaKaRa, Japan) according to the manufacturer’s instructions ...
-
bioRxiv - Cancer Biology 2022Quote: ... The cDNA was amplified with gene-specific primers (Supplemental Table 1) and SYBR Premix Ex Taq II kit (TaKaRa). Data were analyzed using a 2−ΔΔCt method.
-
bioRxiv - Genetics 2021Quote: ... cDNA synthesis was done using 0.1-1 μg approximately of RNA following the manufacturer protocol (Takara Bio, Kusatsu, Japan). We used the 2xPrimeTime® Gene Expression Master Mix (Takara Bio) ...
-
bioRxiv - Cancer Biology 2021Quote: ... with PCR using the primers listed in Table 1 and cloned into pmCherry-C1 (CMV promoter; Takara Bio Inc.). pEGFP-C3 K19 WT ...
-
bioRxiv - Genetics 2022Quote: ... 1 µg of total RNA was used for reverse transcription using PrimeScript RT Reagent Kit (Cat#RR037A, TaKaRa, Japan). Quantitative polymerase chain reaction (qPCR ...
-
bioRxiv - Cell Biology 2019Quote: ... 10 µg of the lysates were separated by SDS-PAGE and blots were probed with a 1:2,000 dilution of mouse anti-GFP antibody (Clontech), followed by 1:5000 anti-mouse Starbright Blue 700 (Bio-Rad ...
-
bioRxiv - Molecular Biology 2020Quote: ... Samples were analyzed on bleach agarose gels (0.06% bleach, 1% (w/v) agarose) for visualization of the RNA and on WB (anti-His antibody, Clontech) for visualization of His6-tagged Nsp1.
-
bioRxiv - Pathology 2020Quote: ... A total of 1 × 106 cells were used for total RNA extraction using RNAiso Plus reagent (Cat.#9109, TaKaRa), followed by treatment with 10 U of recombinant DNase I (Cat.#2270A ...
-
bioRxiv - Molecular Biology 2021Quote: ... The insoluble material was removed by centrifugation at 150,000 ×g and the supernatant was added to 1 ml pure TALON resin (Clontech) and 20 mM imidazole and rock slowly overnight at 4 °C ...
-
bioRxiv - Cell Biology 2020Quote: ... 35 mm wells of MIN6 cells were co-transfected with 2.5 µg of pX330 containing gRNAs and 1 µg of pEGFP-C2 (Clontech). After 48 h ...
-
bioRxiv - Microbiology 2020Quote: ... primary antibody was prepared in PBS containing 1% non-fat milk using anti-hexahistidine antibody (Takara Bio, catalog #631212) at a dilution of 1:3000 ...
-
bioRxiv - Genomics 2021Quote: ... or SL medium (for E14-STNΔTsixP) and transduced the next day with 1ml of 5:1 concentrated (lenti-X, Clontech) and filtered viral supernatant with 8 ng/µl polybrene (Sigma Aldrich) ...
-
Mck1 defines a key S-phase checkpoint effector in response to various degrees of replication threatsbioRxiv - Molecular Biology 2019Quote: ... DNA was transferred to HyBond N+ in transfer buffer (0.4 M NaOH, 1 M NaCl) and UV cross-linked before hybridization with a random primed probe (Takara) overnight at 42°C and washed twice for 20 min with 0.5× SSC 0.1% SDS at 65°C.
-
bioRxiv - Cell Biology 2021Quote: ... 1-2ug of RNA was used to synthesise cDNA using Superscript III or PrimeScript kit (Thermo Fisher Scientific, Takara). Quantitative PCR (qPCR ...
-
bioRxiv - Genomics 2021Quote: ... Non-tissue culture treated 12-well plates were prepared by incubating 1 mL PBS + 25 μg/mL Retronectin (Takara) overnight at 4°C ...
-
bioRxiv - Developmental Biology 2020Quote: ... Primary antibodies for embryo staining were used at the following final dilutions: rabbit anti-DsRed (1:400, Clontech 632496), rat anti-tropomyosin (1:200 ...
-
bioRxiv - Developmental Biology 2021Quote: ... The cDNA was synthesized with 1 ug total RNA using the PrimeScriptTM RT Reagent Kit with gDNA Eraser (TaKaRa). qRT-PCR was performed using a qTOWER3G system (analytikjena ...
-
bioRxiv - Plant Biology 2021Quote: ... The samples were immobilized by molten 1.5% low-melting point agarose (Agarose LMT 1-20K, PrimeGel, Takara Bio Inc.) spread thinly on a glass-bottom dish and immediately covered in water ...
-
bioRxiv - Immunology 2020Quote: ... 1 μg of RNA per sample was used for first-strand synthesis by SMARTer PCR cDNA Synthesis Kit (Clontech). For quantitative RT-PCR (qPCR) ...
-
bioRxiv - Immunology 2021Quote: ... 100,000 cells were sorted into 200 uL PBS with 1 uM DTT and 5 uL RNase Inhibitor Cocktail (Takara); for ex vivo culture experiments ...
-
bioRxiv - Evolutionary Biology 2020Quote: The water-in-oil droplets after the incubation step were diluted 10000-fold with 1 mM EDTA (pH 8.0) and subjected to RT-qPCR (PrimeScript One Step RT-PCR Kit (TaKaRa)) with primer 1 and 2 after heating at 95 °C for 5 min ...
-
bioRxiv - Genetics 2020Quote: ... Total RNA (1 mg) was reverse transcribed using the PrimeScript RT Reagent Kit with the gDNA Eraser (TAKARA, Japan). Quantitative PCR reactions were performed using the gene-specific primers of FLC and FT (Table S1 ...
-
bioRxiv - Microbiology 2022Quote: ... A 5 µl aliquot was removed from each sample for immunoblots using mouse anti-GFP (1:5,000, Clontech #632381) to detect A3-EGFP ...
-
bioRxiv - Biochemistry 2022Quote: ... MBL) and HRP-labeled IgG detector (1/5,000 dilution from the product, Western BLoT Rapid Detect v2.0, Takara Bio) were used as primary and secondary antibodies ...
-
bioRxiv - Cell Biology 2022Quote: ... Complementary DNA (cDNA) was prepared from 1 μg of RNA using PrimeScriptTM RT Master Mix (catalog no. RR036A, Takara). qPCR was performed using TB Green Premix Ex TaqTM (catalog no ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... The measurement was performed after diluting the droplets 100-fold with 1 mM EDTA (pH 8.0) and using One Step TB Green PrimeScript PLUS RT-PCR Kit (Takara).
-
bioRxiv - Genomics 2022Quote: Sequencing libraries were prepared using 1-10 ng of cfDNA and the ThruPLEX® Plasma-seq Kit (Takara Bio) according to the manufacturer’s instructions ...
-
bioRxiv - Plant Biology 2022Quote: ... 10 µl of RNA extraction mixture was then added to 1 µl of 10 mM dNTPs (Takara Catalog # 4030) and 100 mM of oligo-dT(18 ...
-
bioRxiv - Cell Biology 2023Quote: ... 2xmCh-KIF5C in pcDNA3.1 was cloned by inserting in-frame KIF5C full length from EGFP-KIF5C (a gift from Anthony Brown) 2xmCh sequence from KIF5C(1-560)-2xmCh-EF(C) into pcDNA3.1 using InFusion Cloning kit (Takara). EGFP-Rab7A (Addgene #28047 ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 1 ug of RNA was reverse-transcribed into cDNAs using the Prime Script RT Reagent Kit (Takara, RR037B) according to the manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2023Quote: ... 1 μg of total RNA was reverse transcribed using the double primed RNA to cDNA EcoDry premix (Takara Bio). Primers were designed targeting FLuc ...
-
bioRxiv - Genomics 2023Quote: ... The ligation reaction (1 µL) was transformed into 50 µL of Escherichia coli HST08 premium electro-cells (Takara, Japan) using a Gene Pulser Xcell (Bio-Rad ...
-
bioRxiv - Biochemistry 2023Quote: ... cDNA was prepared from 1 µg of total RNA using the PrimeScript RT Reagent Kit with gDNA Eraser (Takara). Real-time polymerase chain reaction (real-time PCR ...
-
bioRxiv - Plant Biology 2023Quote: ... The full-length and truncate CDS of TaNAM-A1a (residues 1–220) were cloned into bait vector pGBKT7 (Clontech) respectively to generate bait plasmids BD-NAM-A1full and BD-NAM-A11-220 ...
-
bioRxiv - Molecular Biology 2023Quote: ... Equal loading of the GFP tagged E2F1 proteins was determined by the GFP antibody (Clontech, lot. 1404005; 1:2000) the secondary antibody anti-rabbit HRP (Na934v ...
-
bioRxiv - Neuroscience 2023Quote: ... the solution was replaced with a 0.5% BSA and 0.2% Triton X/PBS solution (PBST) containing a 1:1,000 dilution of Rabbit anti-DsRed (Takara, #632496) or Chicken Polyclonal anti-GFP antibody (Abcam ...
-
bioRxiv - Neuroscience 2024Quote: ... HEK293 cells were first incubated with ARIAD ligand at a concentration of 1 µM (AL; D/D Solubilizer; Takara) for the indicated times ...
-
bioRxiv - Microbiology 2024Quote: ... cDNA was synthesized from 1 µg of each RNA sample using PrimeScript RT Reagent Kit with gDNA Eraser (Takara), and the primers used for qRT-PCR were designed using Primer3web ...
-
bioRxiv - Microbiology 2024Quote: ... the dish was split into two 1-ml Petri dishes and one was treated with rapalog (250 nM, Clontech) for 4 hours to induce the knock-sideway while the other served as control.
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Neuroscience 2019Quote: ... and 96 hours post transfection viral particle containing supernatants were harvested and filtered through a 0.45μm PES syringe filter (Membrane Solutions, Cat. Nr. SFPES030045S) followed by a 6-fold concentration using Lenti-X-Concentrator (Clontech, Cat. Nr. 631232) according to the manufacturer’s instructions.
-
bioRxiv - Molecular Biology 2020Quote: ... cells were cultured at a density of 1 × 106 per well in a 6 well dish and the cell number was counted daily under microscopy using trypan blue staining (Takara, Japan. Cat# Y50015). Cells were also seeded at a low density in 96 well plate (5000 cells per well ...
-
bioRxiv - Immunology 2021Quote: ... 2.5 mM dNTP and 2 U/μL of recombinant RNase inhibitor (Clontech) then spun down and frozen at –80 °C.
-
bioRxiv - Developmental Biology 2020Quote: ... Yeast transformation was conducted with Yeast Transformation System 2 (Clontech NO.630439). All primers used were listed in supplementary Table 1.
-
bioRxiv - Microbiology 2020Quote: ... 2 µl of dNTP mix (TaKaRa, 2.5 mM concentration, 200 µM final), 0.125 µl of HotStart ExTaq (TaKaRa ...
-
bioRxiv - Microbiology 2019Quote: ... ISC5 and ISC5 groups using Advantage 2 Polymerase Mix (TAKARA, Kusatsu, Japan). 2µl of template with varying DNA concentration were used in a total of 50µl PCR reaction (S1 Dataset A) ...