Labshake search
Citations for Avanti Polar Lipids :
901 - 950 of 2352 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2022Quote: Lyophilized 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) and 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-(Cap Biotinyl) (DOPE-cap-B) were purchased from Avanti Polar Lipids (Alabaster, USA). Lyophilised streptavidin (SAv ...
-
bioRxiv - Cancer Biology 2022Quote: ... from Avanti Polar Lipids (Alabaster, AL). Lipids were dissolved in chloroform and rotary evaporated to produce a lipid film ...
-
bioRxiv - Cell Biology 2022Quote: ... Levels of oxysterols levels were measured with isotope dilution mass spectrometry using a mixture of primary and deuterated standards (Avanti Polar Lipids) added to the sample prior to extraction as a standard for quantification ...
-
bioRxiv - Biochemistry 2022Quote: ... Biobeads were strained and the resulting sample was extruded through a 200nm membrane (Avanti Polar Lipids extruder ...
-
bioRxiv - Biochemistry 2022Quote: ... 25mg/ml POPC and POPG (Avanti Polar Lipids) chloroform solutions were mixed with a ratio of 3:1 ...
-
bioRxiv - Biochemistry 2022Quote: Purification and reconstitution of the protein in d54-DMPC and d22-DHPC (Avanti Polar Lipids) q=0.33 bicelles was performed as exactly described previously 46.
-
bioRxiv - Bioengineering 2022Quote: ... smegmatis and then co-extruded nine times through a 100 nm pore size polycarbonate porous membrane using a mini extruder (Avanti Polar Lipids). Excess OMVs and soluble compounds were removed from the supernatant after centrifugation at 15000 g for 10 minutes at 4°C ...
-
bioRxiv - Biophysics 2022Quote: ... coli polar lipids and L-α-phosphocholine (Avanti Polar Lipids) were dissolved in chloroform and evaporated with a rotary evaporator ...
-
bioRxiv - Biochemistry 2022Quote: ... The lipid 1,2-diphytanoyl-sn-glycero-3-phospho-(1’-rac-glycerol) (DPhPG) was purchased from Avanti Polar Lipids, Inc ...
-
bioRxiv - Biochemistry 2022Quote: ... 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[biotinyl-(polyethylene glycol)-2000] (Biotinyl-PEG-DSPE) and N-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)dioleoylphosphatidylethanolamine (N-NBD-DOPE) were obtained from Avanti Polar lipids Inc ...
-
bioRxiv - Biochemistry 2022Quote: ... egg sphingomyelin (SM) and edelfosine were purchased from Avanti Polar lipids. The ATP8B1 C-terminal peptide RRSAYAFSHQRGYADLISSGRSIRKKRSPLDAIVADGTAEYRRTGDS ...
-
bioRxiv - Systems Biology 2022Quote: ... Internal standard mix – EquiSPLASH LIPIDOMIX (MS-quantitative grade) was obtained from Avanti Polar Lipids.
-
bioRxiv - Biophysics 2022Quote: ... and cholesterol were purchased from Avanti Polar Lipids. PEG 8000 was purchased form Fisher Scientific ...
-
bioRxiv - Molecular Biology 2022Quote: ... with the following lipid molar ratio to obtain red fluorescent vesicles: 99.5 % 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) (Avanti Polar Lipids Inc., Alabaster, Alabama) and 0.5 % Texas Red 1,2 Dihexadecanoyl-sn-Glycero-3-Phosphoethanolamin (Texas Red DHPE ...
-
bioRxiv - Microbiology 2022Quote: ... an extrusion with a 100-nm filter was performed to calibrate LUVs toward 70-nm diameter (mini-extruder with polycarbonate filters, Avanti Polar Lipids).
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... and 1,2-dipalmitoyl-3-trimethylammonium-propane (DPTAP; Avanti Polar Lipids) was 17:3 (Hirakawa et al. ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... except that the weight ratio of 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC; Avanti Polar Lipids, Alabaster, AL) and 1,2-dipalmitoyl-3-trimethylammonium-propane (DPTAP ...
-
bioRxiv - Cell Biology 2022Quote: ... Internal standards (ISTD) added to the tissues before extraction included 500 pmol (20 μl) of Cer/Sph Mixture I (Avanti Polar Lipids LM-6002), and 1nmol of C12 Sphingosyl PE (C17:1/C12:0 ...
-
bioRxiv - Cell Biology 2022Quote: ... and 1nmol of C12 Sphingosyl PE (C17:1/C12:0) (Avanti Polar Lipids). Lipids from all samples were normalized to carbon content (100μg/ml ...
-
bioRxiv - Biophysics 2022Quote: ... and 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (POPE) lipids from Avanti Polar Lipids were dissolved in chloroform and quantified by phosphate analysis ...
-
bioRxiv - Cell Biology 2022Quote: ... Internal standards (ISTD) added to the tissues before extraction included 500 pmol (20 μl) of Cer/Sph Mixture I (Avanti Polar Lipids LM-6002), and 1nmol of C12 Sphingosyl PE (C17:1/C12:0 ...
-
bioRxiv - Cell Biology 2022Quote: ... and 1nmol of C12 Sphingosyl PE (C17:1/C12:0) (Avanti Polar Lipids). Lipids from all samples were normalized to carbon content (100μg/ml ...
-
bioRxiv - Bioengineering 2022Quote: ... the liposome solution was extruded through 400 nm and 200 nm polycarbonate membranes (Whatman, USA) for 11 passages each using a Mini Extruder (Avanti Polar Lipids, USA). Afterward ...
-
bioRxiv - Biophysics 2022Quote: 1,2-diphytanoyl-sn-glycero-3-phosphocholine (DPhPC, Avanti Polar Lipids, USA) was used to form small unilamellar vesicles (SUV’s) ...
-
bioRxiv - Biophysics 2022Quote: ... The solution was freeze-thawed at least 6 times under liquid nitrogen and then extruded 21 times using an Avanti pressure extruder with Whatmanfilter paper of size 0.1 μm (Avanti Polar Lipids Alabama ...
-
bioRxiv - Molecular Biology 2022Quote: ... NBD-PS (Avanti polar lipids) were dried and re-suspended in RPMI to 1 mM stock solutions and stored at -20°C ...
-
bioRxiv - Molecular Biology 2022Quote: All lipids were purchased from Avanti Polar Lipids. 1-palmitoyl-2-oleoyl-glycero-3-phosphocholine (POPC) ...
-
Nanoparticle-delivered TLR4 and RIG-I agonists enhance immune response to SARS-CoV-2 subunit vaccinebioRxiv - Immunology 2022Quote: ... or MPLA PHAD® (1 μg/mg PLGA, Avanti Polar Lipids, Cat# 699800P) was dissolved the DCM added to the first water-oil emulsion ...
-
bioRxiv - Immunology 2022Quote: ... using a 1 ml mini-extruder (Avanti Polar Lipids) to get monodispersed ACM-antigen vesicles ...
-
bioRxiv - Immunology 2022Quote: ... 1,2-dioleoyl-3-trimethylammonium-propane (DOTAP) was from Avanti Polar Lipids. Triton X-100 was from MP Biomedicals ...
-
bioRxiv - Microbiology 2022Quote: ... 1-oleoyl-2-palmitoyl-sn-glycero-3-phosphocholine (Avanti Polar Lipids), sn-(1-oleoyl-2-hydroxy)-glycerol-3-phospho-sn-3′-(1′-oleoyl-2’-hydroxy)-glycerol (ammonium salt ...
-
bioRxiv - Immunology 2022Quote: ... using established multiple reaction monitoring pairs and retention times were compared to repeated injections of OxysterolSPLASH™ standard mix (Avanti Polar Lipids) in an extraction control sample of rhesus BAL ...
-
bioRxiv - Microbiology 2022Quote: ... Liposomes consisted of 4:4:2:0.1:2 × 10−4 ratio of 1,2,dioleoyl-sn-glycero-3-phosphocholine (Avanti Polar Lipids), 1-oleoyl-2-palmitoyl-sn-glycero-3-phosphocholine (Avanti Polar Lipids) ...
-
bioRxiv - Immunology 2022Quote: ... 10µl of 100µM 27-hydroxycholesterol-d6 (Avanti Polar Lipids) was added as an internal standard and 300µl of standard-containing sample was transferred dropwise to 3ml of a 1:1 dichloromethane:methanol mixture in a nitrogen evacuated glass tube ...
-
bioRxiv - Plant Biology 2022Quote: ... plants were vacuum-infiltrated with 0.5 mg/mL sonicated NBD-PA (Avanti Polar Lipids, Alabaster, AL) and 0.05 % (v/v ...
-
bioRxiv - Plant Biology 2022Quote: Ten μmol of phosphatidylcholine (PC) or a 3:1 (mol/mol) mixture of PC and PA (Avanti Polar Lipids) were dried with gentle stream of nitrogen gas ...
-
bioRxiv - Synthetic Biology 2022Quote: POPC (1-palmitoyl-2-oleoyl-glycero-3-phosphocholine) and cholesterol were purchased from Avanti Polar Lipids Inc ...
-
bioRxiv - Pathology 2022Quote: ... and supernatants were supplemented with NP-40 (1%, Hölzel Diagnostika Handels GmbH #P-1505) and 1,2-diheptanoyl-sn-glycero-3-phosphocholine (DHPC, 30mM, Avanti Polar Lipids ##850306P), incubated (5min. ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... All lipids for liposome formulation were obtained from Avanti Polar Lipids (Alabaster, AL). Pooled rat IgG (rIgG ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) and cholesterol were from Avanti Polar lipids (Alabaster, AL). Ovalbumin (OVA) ...
-
bioRxiv - Biochemistry 2022Quote: ... PIP2 was purchased from Avanti Polar Lipids (Alabama, USA). Bovine ubiquitin and 5,5’-dithiobis-(2-nitrobenzoic acid ...
-
bioRxiv - Biochemistry 2022Quote: ... 48 μM brain phosphatidylinositol 4,5-bisphosphate (PIP2, Avanti Polar Lipids) in 12 x 75 mm borosilicate tubes ...
-
bioRxiv - Neuroscience 2022Quote: ... sphingosine (Avanti Polar Lipids, cat # 860490P), and S1P (Avanti Polar Lipids ...
-
bioRxiv - Cancer Biology 2022Quote: ... were purchased from Avanti Polar Lipids (stored at -80 °C). A 1 mg/ml stock solution of DOPE/DOTAP with a weight ratio of 1:1 was prepared ...
-
bioRxiv - Cancer Biology 2022Quote: ... a mini-extruder instrument (Avanti Polar Lipids) was used to gently extrude the Luc-Ce6/Fuso-lip solution several times through membrane filters with 100 nm pore sizes for in vitro experiments or 50 nm pore sizes for in vivo experiments ...
-
bioRxiv - Bioengineering 2022Quote: ... 1,2-dibehenoyl-sn-glycero-3-phosphocholine (DBPC) from Avanti Polar Lipids Inc ...
-
bioRxiv - Biochemistry 2022Quote: ... and 1,2-dioleoyl-sn-glycero-3-[(N-(5-amino-1-carboxypentyl)iminodiacetic acid)succinyl] (nickel salt) (DGS-NTA(Ni2+) were purchased from Avanti Polar Lipids. DOPC was the bulk lipid in all experiments ...
-
bioRxiv - Microbiology 2022Quote: ... EquiSPLASH lipidomics internal standard was obtained from Avanti Polar Lipids. Anti-dsRNA antibody was obtained from Millipore (identifier MABE1134) ...
-
bioRxiv - Microbiology 2022Quote: ... cholesterol and rhodamine-labelled phosphatidylethanolamine (Avanti Polar Lipids) (molar ratios 44.5:44.5:10:1 respectively ...
-
bioRxiv - Microbiology 2022Quote: ... 10 mM Hepes pH 7.5 and extrusion through 400 nm pore-size membranes using a mini-extruder (Avanti Polar Lipids). The lipid concentration of liposome preparations was estimated by comparing the level of rhodamine fluorescence in the liposome sample relative to samples of rehydrated lipids of known concentration ...