Labshake search
Citations for Avanti Polar Lipids :
751 - 800 of 2211 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2022Quote: ... 10 mg liposomes (Avanti Polar Lipids) were dissolved in 1 mL buffer (50 mM Tris-HCl ...
-
bioRxiv - Neuroscience 2022Quote: ... and S1P (Avanti Polar Lipids, cat # 860492P) and applied to the CIR ...
-
bioRxiv - Bioengineering 2022Quote: ... and 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[carboxy(polyethylene glycol)-2000] (sodium salt) (DSPE-PEG2000-COOH) were purchased from Avanti Polar Lipids, Inc ...
-
bioRxiv - Microbiology 2022Quote: ... coli total membrane PL extracts (Avanti Polar Lipids) as described (Conti et al. ...
-
bioRxiv - Molecular Biology 2022Quote: ... All phospholipids were purchased from Avanti Polar Lipids (catalog numbers 840012C ...
-
bioRxiv - Cell Biology 2022Quote: ... coli polar lipids (Avanti polar lipids) dissolved in chloroform and supplemented with 0.2 mol % 18:1 Liss Rhodamine PE (Avanti polar lipids ...
-
bioRxiv - Cell Biology 2022Quote: ... Lipid standards used were PE25:0 and PE43:6 (Avanti Polar Lipids). The data were corrected for isotope effects as described by (Liebisch ...
-
bioRxiv - Biophysics 2022Quote: Lyophilized 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) and 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-(Cap Biotinyl) (DOPE-cap-B) were purchased from Avanti Polar Lipids (Alabaster, USA). Lyophilised streptavidin (SAv ...
-
bioRxiv - Cancer Biology 2022Quote: ... from Avanti Polar Lipids (Alabaster, AL). Lipids were dissolved in chloroform and rotary evaporated to produce a lipid film ...
-
bioRxiv - Cell Biology 2022Quote: ... Levels of oxysterols levels were measured with isotope dilution mass spectrometry using a mixture of primary and deuterated standards (Avanti Polar Lipids) added to the sample prior to extraction as a standard for quantification ...
-
bioRxiv - Biochemistry 2022Quote: ... Biobeads were strained and the resulting sample was extruded through a 200nm membrane (Avanti Polar Lipids extruder ...
-
bioRxiv - Biochemistry 2022Quote: ... 25mg/ml POPC and POPG (Avanti Polar Lipids) chloroform solutions were mixed with a ratio of 3:1 ...
-
bioRxiv - Biochemistry 2022Quote: Purification and reconstitution of the protein in d54-DMPC and d22-DHPC (Avanti Polar Lipids) q=0.33 bicelles was performed as exactly described previously 46.
-
bioRxiv - Bioengineering 2022Quote: ... smegmatis and then co-extruded nine times through a 100 nm pore size polycarbonate porous membrane using a mini extruder (Avanti Polar Lipids). Excess OMVs and soluble compounds were removed from the supernatant after centrifugation at 15000 g for 10 minutes at 4°C ...
-
bioRxiv - Biophysics 2022Quote: ... coli polar lipids and L-α-phosphocholine (Avanti Polar Lipids) were dissolved in chloroform and evaporated with a rotary evaporator ...
-
bioRxiv - Biochemistry 2022Quote: ... The lipid 1,2-diphytanoyl-sn-glycero-3-phospho-(1’-rac-glycerol) (DPhPG) was purchased from Avanti Polar Lipids, Inc ...
-
bioRxiv - Biochemistry 2022Quote: ... 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[biotinyl-(polyethylene glycol)-2000] (Biotinyl-PEG-DSPE) and N-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)dioleoylphosphatidylethanolamine (N-NBD-DOPE) were obtained from Avanti Polar lipids Inc ...
-
bioRxiv - Biochemistry 2022Quote: ... egg sphingomyelin (SM) and edelfosine were purchased from Avanti Polar lipids. The ATP8B1 C-terminal peptide RRSAYAFSHQRGYADLISSGRSIRKKRSPLDAIVADGTAEYRRTGDS ...
-
bioRxiv - Systems Biology 2022Quote: ... Internal standard mix – EquiSPLASH LIPIDOMIX (MS-quantitative grade) was obtained from Avanti Polar Lipids.
-
bioRxiv - Biophysics 2022Quote: ... and cholesterol were purchased from Avanti Polar Lipids. PEG 8000 was purchased form Fisher Scientific ...
-
bioRxiv - Molecular Biology 2022Quote: ... with the following lipid molar ratio to obtain red fluorescent vesicles: 99.5 % 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) (Avanti Polar Lipids Inc., Alabaster, Alabama) and 0.5 % Texas Red 1,2 Dihexadecanoyl-sn-Glycero-3-Phosphoethanolamin (Texas Red DHPE ...
-
bioRxiv - Microbiology 2022Quote: ... an extrusion with a 100-nm filter was performed to calibrate LUVs toward 70-nm diameter (mini-extruder with polycarbonate filters, Avanti Polar Lipids).
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... and 1,2-dipalmitoyl-3-trimethylammonium-propane (DPTAP; Avanti Polar Lipids) was 17:3 (Hirakawa et al. ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... except that the weight ratio of 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC; Avanti Polar Lipids, Alabaster, AL) and 1,2-dipalmitoyl-3-trimethylammonium-propane (DPTAP ...
-
bioRxiv - Cell Biology 2022Quote: ... Internal standards (ISTD) added to the tissues before extraction included 500 pmol (20 μl) of Cer/Sph Mixture I (Avanti Polar Lipids LM-6002), and 1nmol of C12 Sphingosyl PE (C17:1/C12:0 ...
-
bioRxiv - Cell Biology 2022Quote: ... and 1nmol of C12 Sphingosyl PE (C17:1/C12:0) (Avanti Polar Lipids). Lipids from all samples were normalized to carbon content (100μg/ml ...
-
bioRxiv - Biophysics 2022Quote: ... and 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (POPE) lipids from Avanti Polar Lipids were dissolved in chloroform and quantified by phosphate analysis ...
-
bioRxiv - Cell Biology 2022Quote: ... Internal standards (ISTD) added to the tissues before extraction included 500 pmol (20 μl) of Cer/Sph Mixture I (Avanti Polar Lipids LM-6002), and 1nmol of C12 Sphingosyl PE (C17:1/C12:0 ...
-
bioRxiv - Cell Biology 2022Quote: ... and 1nmol of C12 Sphingosyl PE (C17:1/C12:0) (Avanti Polar Lipids). Lipids from all samples were normalized to carbon content (100μg/ml ...
-
bioRxiv - Bioengineering 2022Quote: ... the liposome solution was extruded through 400 nm and 200 nm polycarbonate membranes (Whatman, USA) for 11 passages each using a Mini Extruder (Avanti Polar Lipids, USA). Afterward ...
-
bioRxiv - Biophysics 2022Quote: 1,2-diphytanoyl-sn-glycero-3-phosphocholine (DPhPC, Avanti Polar Lipids, USA) was used to form small unilamellar vesicles (SUV’s) ...
-
bioRxiv - Biophysics 2022Quote: ... The solution was freeze-thawed at least 6 times under liquid nitrogen and then extruded 21 times using an Avanti pressure extruder with Whatmanfilter paper of size 0.1 μm (Avanti Polar Lipids Alabama ...
-
bioRxiv - Molecular Biology 2022Quote: ... NBD-PS (Avanti polar lipids) were dried and re-suspended in RPMI to 1 mM stock solutions and stored at -20°C ...
-
bioRxiv - Molecular Biology 2022Quote: All lipids were purchased from Avanti Polar Lipids. 1-palmitoyl-2-oleoyl-glycero-3-phosphocholine (POPC) ...
-
Nanoparticle-delivered TLR4 and RIG-I agonists enhance immune response to SARS-CoV-2 subunit vaccinebioRxiv - Immunology 2022Quote: ... or MPLA PHAD® (1 μg/mg PLGA, Avanti Polar Lipids, Cat# 699800P) was dissolved the DCM added to the first water-oil emulsion ...
-
bioRxiv - Immunology 2022Quote: ... using a 1 ml mini-extruder (Avanti Polar Lipids) to get monodispersed ACM-antigen vesicles ...
-
bioRxiv - Immunology 2022Quote: ... 1,2-dioleoyl-3-trimethylammonium-propane (DOTAP) was from Avanti Polar Lipids. Triton X-100 was from MP Biomedicals ...
-
bioRxiv - Microbiology 2022Quote: ... 1-oleoyl-2-palmitoyl-sn-glycero-3-phosphocholine (Avanti Polar Lipids), sn-(1-oleoyl-2-hydroxy)-glycerol-3-phospho-sn-3′-(1′-oleoyl-2’-hydroxy)-glycerol (ammonium salt ...
-
bioRxiv - Immunology 2022Quote: ... using established multiple reaction monitoring pairs and retention times were compared to repeated injections of OxysterolSPLASH™ standard mix (Avanti Polar Lipids) in an extraction control sample of rhesus BAL ...
-
bioRxiv - Microbiology 2022Quote: ... Liposomes consisted of 4:4:2:0.1:2 × 10−4 ratio of 1,2,dioleoyl-sn-glycero-3-phosphocholine (Avanti Polar Lipids), 1-oleoyl-2-palmitoyl-sn-glycero-3-phosphocholine (Avanti Polar Lipids) ...
-
bioRxiv - Immunology 2022Quote: ... 10µl of 100µM 27-hydroxycholesterol-d6 (Avanti Polar Lipids) was added as an internal standard and 300µl of standard-containing sample was transferred dropwise to 3ml of a 1:1 dichloromethane:methanol mixture in a nitrogen evacuated glass tube ...
-
bioRxiv - Plant Biology 2022Quote: ... plants were vacuum-infiltrated with 0.5 mg/mL sonicated NBD-PA (Avanti Polar Lipids, Alabaster, AL) and 0.05 % (v/v ...
-
bioRxiv - Plant Biology 2022Quote: Ten μmol of phosphatidylcholine (PC) or a 3:1 (mol/mol) mixture of PC and PA (Avanti Polar Lipids) were dried with gentle stream of nitrogen gas ...
-
bioRxiv - Synthetic Biology 2022Quote: POPC (1-palmitoyl-2-oleoyl-glycero-3-phosphocholine) and cholesterol were purchased from Avanti Polar Lipids Inc ...
-
bioRxiv - Pathology 2022Quote: ... and supernatants were supplemented with NP-40 (1%, Hölzel Diagnostika Handels GmbH #P-1505) and 1,2-diheptanoyl-sn-glycero-3-phosphocholine (DHPC, 30mM, Avanti Polar Lipids ##850306P), incubated (5min. ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... All lipids for liposome formulation were obtained from Avanti Polar Lipids (Alabaster, AL). Pooled rat IgG (rIgG ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC) and cholesterol were from Avanti Polar lipids (Alabaster, AL). Ovalbumin (OVA) ...
-
bioRxiv - Biochemistry 2022Quote: ... PIP2 was purchased from Avanti Polar Lipids (Alabama, USA). Bovine ubiquitin and 5,5’-dithiobis-(2-nitrobenzoic acid ...
-
bioRxiv - Biochemistry 2022Quote: ... 48 μM brain phosphatidylinositol 4,5-bisphosphate (PIP2, Avanti Polar Lipids) in 12 x 75 mm borosilicate tubes ...
-
bioRxiv - Neuroscience 2022Quote: ... sphingosine (Avanti Polar Lipids, cat # 860490P), and S1P (Avanti Polar Lipids ...