Labshake search
Citations for Sartorius :
101 - 150 of 206 citations for Creatinine Serum Kit 4 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2020Quote: ... and diplopterol (Chiron AS) were dissolved in acetonitrile and filtered with Minisart RC 4 (Sartorius, Stonehouse, UK) before applying 5 μl aliquots to a Acquity UPLC BEH C18 column (1.7 μm ...
-
bioRxiv - Microbiology 2020Quote: ... Eluted total IgG was concentrated by centrifugation at 4°C for 30 mins using 100000MWCO vivaspin (Sartorius). The concentrate was then dialyzed using a dialysis tube (Millipore ...
-
bioRxiv - Biophysics 2022Quote: ... Dialyzed protein was then concentrated with 10 kDa MWCO Vivaspin centrifugal concentrators (3,500 xg, 4°C) (Sartorius). Protein concentrations were determined by means of fluorescence using an sfGFP calibration curve ...
-
bioRxiv - Biochemistry 2023Quote: ... Samples were then diafiltered at 4°C using 3 kDa cutoff VivaSpin®500 centrifuge filters (Sartorius) for 3 cycles of 20 min at 14,000 rpm ...
-
bioRxiv - Cancer Biology 2022Quote: ... Four images were acquired per well every 4 hours and analyzed by the IncuCyte 2020B software (Sartorius) to determine cell confluence ...
-
bioRxiv - Microbiology 2023Quote: ... which took place overnight on arrival at 4°C (cold room) using 6 Vivaflow200 filtration units (Sartorius) operating in two parallel series ...
-
bioRxiv - Genetics 2022Quote: ... Bacterial concentration was determined by flow cytometry (Becton Dickinson LSRFortessa) such that 150,000 spirochetes per well of an ImageLock 96-well plate (Sartorius) were incubated with either 8µg/mL or 16µg/mL of variant (TP607036;MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDA PLEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCSV ...
-
bioRxiv - Cancer Biology 2023Quote: ... Timelapse imaging to assess spheroid formation in round bottom ULA plates was performed using IncuCyte S3 imaging system (Sartorius). Cells were seeded in 96 well ULA plates and images every 3 hours for 48 hours ...
-
bioRxiv - Cancer Biology 2023Quote: ... cells were seeded in 96 well plate in the presence of 1x Cytotox reagent (cat# ESS4633 or ESS4632; Sartorius), a highly sensitive cyanine nucleic acid dye ...
-
bioRxiv - Cancer Biology 2023Quote: ... 15,000 MDA-MB-231 cells were seeded in 96-well ImageLock plates compatible with the Incucyte Zoom system (Sartorius). 24 hours after seeding a scratch wound was made using the WoundMaker Tool (Sartorius ...
-
bioRxiv - Cell Biology 2024Quote: ... The plate was incubated at 37°C and 5% CO2 and imaged using an Incucyte Live-Cell imager (Sartorius). The red channel used an acquisition time of 400 milliseconds for all replicates and samples ...
-
bioRxiv - Cancer Biology 2024Quote: ... Mitochondrial membrane potential kit (Sartorius, 4775) was used for MMP measurements according to the manufacturer instructions ...
-
bioRxiv - Genetics 2021Quote: ... according to manufacturer’s protocol and cultured at 1×105 cells/mL in CellGenix GMP SCGM serum-free base media (Sartorius CellGenix GmbH, Freiburg, Germany) supplemented with stem cell factor (SCF)(100ng/mL) ...
-
bioRxiv - Genomics 2022Quote: ... according to manufacturer’s protocol and cultured at 1×105 cells/mL in CellGenix GMP SCGM serum-free base media (Sartorius CellGenix GmbH, Freiburg, Germany) supplemented with stem cell factor (SCF)(100ng/mL) ...
-
bioRxiv - Biophysics 2021Quote: ... at pH 7 via centrifugal filter units at 12000 g at 4°C (Vivaspin 500, MWCO 10000, Sartorius). Glycans for native MS analysis were mixed with 1 µM (per monomer ...
-
bioRxiv - Cancer Biology 2021Quote: ... We imaged cells every 6 hours for 4-6 days of treatment using Incucyte Zoom (Sartorius, Michigan, USA). Fluorescence was quantified using four locations in each treated sample by the IncuCyte Zoom 2016B software.
-
bioRxiv - Cancer Biology 2023Quote: ... cell confluency was determined every 4 hours using live cell imaging system Incucyte® S3 (Sartorius, Göttingen, Germany) and plotted relative to initial values.
-
bioRxiv - Biochemistry 2023Quote: ... Obtained EHEP was then concentrated to 15–25 mg/mL using Vivaspin-4 10K columns (Sartorius, Göttingen, Germany). About akuBGL ...
-
bioRxiv - Neuroscience 2023Quote: ... The dialyzed solution was finally concentrated by centrifugation through a Vivaspin Turbo 4 membrane filter (MWCO 10,000; Sartorius) at 3,500 × g for 30-45 min at 4°C.
-
bioRxiv - Genetics 2021Quote: ... Neuronal migration was measured during a 70-hour period from day 40 by transferring cell culture plates to the IncuCyte Live Cell Analysis System (Sartorius). Cells were maintained at 37°C and 5% CO2 with 20X magnification phase contrast images taken of whole wells in every 2 hours for the analysis period ...
-
bioRxiv - Cancer Biology 2022Quote: ... GFP-NANOG MDA-MB-231 cells were plated on fibronectin-coated (30 μg/mL) glass 96 well plates and placed in an Incucyte S3 (Sartorius) live cell imaging system ...
-
bioRxiv - Cancer Biology 2022Quote: ... Basolateral compartments were filled with culture medium containing 10% FBS and plates were placed in an Incucyte S3 Imaging System (Sartorius). Images of the apical and basolateral sides of the porous membrane were captured every 4 hours over 3 days ...
-
bioRxiv - Cancer Biology 2019Quote: TNBC control and gene knocked down cells (500/well) were seeded in 384 well plate and transferred to Incucyte ZOOM analysis system (Sartorius) that was maintained at 37 °C ...
-
bioRxiv - Developmental Biology 2022Quote: ... cells were grown on a 96-well plate and placed in the incubated chamber of an Incucyte ZOOM Microscope (Sartorius). EpiLC differentiation medium was added and supplemented with 5µM of Caspase 3/7 Green dye (Sartorius ...
-
bioRxiv - Cancer Biology 2022Quote: ... 5 x 104 cells were seeded in each well of an Incucyte® ImageLock 96-well plate (Sartorius, Catalog #: 4379) in 100 μL/well of either complete RPMI or DMEM ...
-
bioRxiv - Genetics 2023Quote: ... 500 cells were seeded in duplicates in 96-well plates and treated with 1 µg/ml dox for 9-10 days and analyzed with Incucyte (Sartorius). Untreated cells served as reference.
-
bioRxiv - Cancer Biology 2023Quote: ... 7500 cells per genotype were seeded in 96-well plates in both media conditions and proliferation was monitored via the IncuCyte Zoom imaging platform (Sartorius) for up to 72 hours ...
-
bioRxiv - Immunology 2023Quote: HeLa and MDA-MB-231 WT and ARPC5-KO cells were seeded in a 96-well ImageLock plate (Sartorius #4806) and incubated for 24 h ...
-
bioRxiv - Microbiology 2023Quote: ... Plates of infected macrophages were imaged in triplicate per well in an Incucyte S3 Live-Cell Analysis Platform (Sartorius #4647). Phase and fluorescence images were collected every hour per well using a 20X objective ...
-
bioRxiv - Molecular Biology 2023Quote: ... 3–5 x103 cells were seeded in 96-well plates and viable cell numbers were determined using the Incucyte (Sartorius) Adherent-Cell-by-Cell module ...
-
bioRxiv - Neuroscience 2023Quote: ... Octet® SAX high precision streptavidin biosensors and Octet® 384TW tilted-bottom plates were purchased from Sartorius (Göttingen, Germany). Peptides were synthesized by GenScript (Piscataway ...
-
bioRxiv - Immunology 2024Quote: ... The mixture was gently resuspended for 60 sec and 50 µl were added in a 96 well image lock plate (Sartorius) on ice ...
-
bioRxiv - Neuroscience 2024Quote: ... Well plates then immediately underwent imaging with an Incucyte SX5 equipped with a SX5 G/O/NIR optical module (Sartorius). Quantifications were conducted with the systems onboard analysis software.
-
bioRxiv - Cancer Biology 2023Quote: ... 2.5 x 103 cells/well were plated in FBS-free media in the upper chamber of a 96-well Incucyte ClearView cell migration plate (8 µm pore size; #4582 Sartorius). Cells were incubated at 37°C for 45 minutes to allow cells to settle on the membrane before adding RPMI-1640 media supplemented with 10% FBS to the bottom chamber ...
-
bioRxiv - Biochemistry 2020Quote: ... oxidized BdiGolSase1 was ultrafiltrated by centrifuging at 10,000 x g and 4°C using a Vivaspin 500 device (Sartorius). To evaluate the reversibility of the process ...
-
bioRxiv - Biochemistry 2021Quote: ... appropriate fractions (selected by 4-20% gradient SDS-PAGE) were pooled and concentrated by centrifugal filtration (Vivaspin 20, 5,000 MWCO PES, Sartorius) for loading onto a Superdex 200 Increase 10/300 GL (GE Healthcare ...
-
bioRxiv - Biophysics 2020Quote: ... 250 mM) at pH 7.5 and 4°C via centrifugal filter units (13000 x g, Vivaspin 500, MWCO 10000 (Sartorius) or Micro Bio-Spin 6 columns (Bio-Rad) ...
-
bioRxiv - Molecular Biology 2022Quote: ... were concentrated to 2 ml by centrifugation 30 min at 4,000xg at 4°C through a 20 ml VivaSpin 20 30 kDa MWCO concentrator (Sartorius, and were diluted with TGE containing 1 mM β-mercaptoethanol to adjust the NaCl concentration to 50 mM ...
-
bioRxiv - Plant Biology 2022Quote: ... The supernatant was filtered with Minisart RC4 (pore size 0.20 µm, diameter 4 mm, Sartorius stedim biotech, Göttingen, Germany) and injected into a high-performance liquid chromatography system (LC-10AD ...
-
bioRxiv - Microbiology 2023Quote: ... Supernatants were thawed and filtrated through a 0.2 µm filter before centrifugation at 4500 x g at 4°C in VivaSpin tubes (Sartorius). The first-generation immunoadhesins do not carry the Twin-Strep-tag and were purified using Protein A Mag Sepharose™ Xtra beads (50 µL beads/mL of supernatant ...
-
bioRxiv - Biochemistry 2023Quote: ... Samples were incubated at room temperature during one hour and labeled proteins were separated from Ir2 and DMSO vehicle by 5 cycles of diafiltration (12,000 g, 4°C, molecular cutoff 10kDa, Sartorius) adding 5 volumes of labeling buffer before each cycle ...
-
bioRxiv - Biochemistry 2023Quote: ... The resulting protein was concentrated to ≈4 mg/mL using a 5 kDa centrifugal concentrator (Vivaspin; Sartorius, Gottingen, Germany). For drop-deposition Raman spectroscopy ...
-
bioRxiv - Immunology 2023Quote: ... Cells were washed once in PBS and kept in 500μL PBS at 4°C in the dark until analysis with an Intellicyt iQue3 Screener (Sartorius). For viability analysis ...
-
bioRxiv - Cell Biology 2023Quote: ... Phase contrast images were acquired every 4 hours over a period of 48 hours using an Incucyte machine (Sartorius). The percentage of cell confluence was calculated using the attached Incucyte®software (Sartorius).
-
bioRxiv - Microbiology 2024Quote: ... The lysate was cleared by centrifugation at 35,000 rcf for 30 minutes at 4°C followed by filtering with a GF filter (Sartorius). The cleared lysate was incubated with 3 mL of Glutathione Sepharose 4B resin (Cytiva ...
-
bioRxiv - Microbiology 2024Quote: ... The lysate was cleared by centrifugation at 35,000 rcf for 45 minutes at 4°C followed by filtering with a GF filter (Sartorius). The cleared lysate was incubated with 2 mL Ni-NTA agarose (Qiagen ...
-
bioRxiv - Microbiology 2024Quote: ... The lysate was cleared by centrifugation at 70,000 rcf for 45 minutes at 4°C followed by filtering with a GF filter (Sartorius). The cleared lysate was incubated with 4 mL of IgG beads (Cytiva ...
-
bioRxiv - Microbiology 2024Quote: ... Lysates were cleared by centrifugation at 35,000 rcf for 45 minutes at 4°C followed by filtering with a GF filter (Sartorius). Cleared lysates were then incubated with 1.5 mL of StrepTactin Sepharose beads (IBA Lifesciences ...
-
bioRxiv - Microbiology 2024Quote: ... Lysates were cleared by centrifugation at 35,000 rcf for 30 minutes at 4°C followed by filtering with a GF filter (Sartorius). For purification of ScaC and ScaC-SNAP ...
-
bioRxiv - Evolutionary Biology 2024Quote: ... approximately 4 mg of pulverized tissue was weighed using an ultra-micro balance (CP2P Microbalance, Sartorius GmbH, Goettingen, Germany), packaged into tin capsules ...