Labshake search
Citations for ProteoGenix :
51 - 100 of 118 citations since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2023Quote: ... coli and cloned into a pT7 expression vector by Proteogenix (www.proteogenix.science). The expected PhDEF protein starts at aminoacid 60 (PSITT… ...
-
bioRxiv - Plant Biology 2023Quote: ... The 6xHis-PhDEF protein was purified by affinity column with a Nickel resin under denaturing conditions (8M urea) by Proteogenix. The purified protein was injected in two rabbits for immunization by Proteogenix ...
-
bioRxiv - Biophysics 2023Quote: ... were synthesized in solid phase using Fmoc strategy (Proteogenix) and resuspended in H2O with pH adjusted.
-
bioRxiv - Cancer Biology 2023Quote: ... inserting the synthetic sequences (ProteoGenix) into a pCDNA3.1 vector ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1 ng/uL anti-SEMA4D monoclonal antibody (Pepinemab Biosimilar, Proteogenix PX-TA1382 or 1 ng/uL anti-PLXNB2 monoclonal antibody (67265-1 ...
-
bioRxiv - Microbiology 2023Quote: Peptides corresponding to the amyloidogenic regions detected within the TasA amyloid core were synthetically produced and purified by Proteogenix (Schiltigheim, France). The sequence of the peptides was ...
-
bioRxiv - Plant Biology 2023Quote: ... was codon-optimized for Pichia pastoris and synthesized without signal peptide in frame with His-tag in pPCIZ-αB by ProteoGenix (Schiltigheim, France). rTBL38 was produced in P ...
-
bioRxiv - Biochemistry 2023Quote: ... BRCA2 BRC4: Biotin-GSG-IKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ (synthesized by Proteogenix and Genecust) have been measured by BLI using an Octet RED96 instrument (FortéBio ...
-
bioRxiv - Bioengineering 2023Quote: ... The peptide solution (CGGRGDSPG, Proteogenix, free of TFA, 1.6 mg/ mL in PBS; 2 mL) was added to the emulsion and incubated for 1 h at room temperature ...
-
bioRxiv - Plant Biology 2023Quote: For elf18 (Proteogenix) treatment ...
-
bioRxiv - Microbiology 2022Quote: ... The peptide corresponding to the periplasmic extension of ExbBsm (A1PAANPAVTESVAPTTAPAPAAAAPESITPVNPAPTIQPPETRG44-numbering with reference to the mature protein) was synthetized by Proteogenix.
-
bioRxiv - Cell Biology 2022Quote: ... 5’-AAC CGC AAT CAC ATC CAC GA-3’/5’-CAC CTC TGC CAT GAT CAC CG-3’) and the repair template (synthesized by ProteoGenix). The repair template was composed of two homology arms of 1000 bp flanking a puromycin resistance gene and mClover3 coding sequence separated by a P2A cleavage site ...
-
bioRxiv - Cell Biology 2022Quote: ... Sotrovimab and Bamlanivimab were purchased from ProteoGenix.
-
bioRxiv - Biochemistry 2022Quote: ... NUT peptides were ordered from Proteogenix.
-
bioRxiv - Developmental Biology 2022Quote: ... All antibodies were generated and affinity-purified by Proteogenix (Schiltigheim, France).
-
bioRxiv - Biochemistry 2022Quote: ... peptide substrate QPKK(Ac),50 µM (Proteogenix), Herring sperm DNA (0.32 mg/ml) ...
-
bioRxiv - Microbiology 2022Quote: Casirivimab and imdevimab (ProteoGenix, Schiltigheim, France) as well as sotrovimab (Abpro ...
-
bioRxiv - Cell Biology 2022Quote: ... two synthesized antigen peptides Cys- TMSLKLKRGNKEKIESALSDA and Cys-DYKKKELALKRLITKAMATR (Figure S1C) were conjugated to KLH carrier and used for raising polyclonal antibody in rabbits (ProteoGenix, France). The detection of HscA using polyclonal antibody was performed by analyzing the protein extracts of A ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Immunology 2022Quote: ... and a Coleoptericin B (ColB) primary polyclonal anti-serum (Proteogenix, Schiltigheim-France) at 1:300 dilution in 0.1% BSA were used ...
-
bioRxiv - Cell Biology 2022Quote: ... Using density gradient centrifugation with PolymorphPrep (Proteogenix, Schiltigheim, France, AN1114683) according to the manufacturer’s instructions ...
-
bioRxiv - Immunology 2022Quote: ... was blocked via the pretreatment of PLTs with 5 μg/mL anti-SELP humanized Ab (anti-CD62p, 15 min, RT; ProteoGenix, Schiltigheim, France). Using a modified FC approach that detects PLT-leukocyte aggregates ...
-
bioRxiv - Biochemistry 2022Quote: Three BH3 peptides derived from TCTP and from the E3 ubiquitine ligase Mule (UniProtKB - Q7Z6Z7) were purchased (Proteogenix) (Fig ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM mutated TAMRA-C-ter BDNF peptide (CellPDD predicting score = 0.03, i.e. mutation abolishing the CPP characteristics : TAMRA-KKEIGWRFIRIDTSCVCTLTIKEGR-COOH; Proteogenix, France), with 1 μM TAMRA-penetratin (positive control ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured on polylysine coverslips and incubated with the TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) corresponding to the 25 amino acids of the C-terminal sequence of BDNF at 1 μM ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-penetratin (positive control, TAMRA -RQIKIWFQNRRMKWKK-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH ...
-
bioRxiv - Cell Biology 2022Quote: ... TAMRA(5-Carboxytetramethylrhodamine)-peptides were synthetized by ProteoGenix (France).
-
bioRxiv - Immunology 2022Quote: The following cDNA constructs were optimized and synthesized (ProteoGenix SAS, Schiltigheim) for expression of the different molecules ...
-
bioRxiv - Immunology 2022Quote: ... The pcDNA3.1 vector coding for human IL-15 was synthesized by ProteoGenix SAS (Strasbourg ...
-
bioRxiv - Microbiology 2022Quote: ... and SARS-CoV-2 M protein was purchased from ProteoGenix (Catalog# PX-COV-P025).
-
bioRxiv - Plant Biology 2022Quote: The codon-optimized PLP was chemically synthesized by Proteogenix (Schiltigheim, France) and then cloned into the pET32a vector (Novagen) ...
-
bioRxiv - Plant Biology 2022Quote: ... or 1 uM flg22 (EZBiolabs, USA or Proteogenix, France), or water ...
-
bioRxiv - Microbiology 2022Quote: ... Antigen retrieval was performed in the 2100 Retriever (ProteoGenix, Schiltigheim, France) using citrate buffer followed by endoperoxidase quenching in 3 % hydrogen peroxide ...
-
bioRxiv - Microbiology 2022Quote: ... The liposomes were then separated by ultracentrifugation on an Optiprep (Proteogenix 1114542) continuous 0-30% gradient ...
-
Immunogenic fusion proteins induce neutralizing SARS-CoV-2 antibodies in the serum and milk of sheepbioRxiv - Bioengineering 2022Quote: ... Plates were then washed six times with 1X PBS with 0.05% Tween (PBST) before 120 μL of ACE2-HRP protein (ProteoGenix, France) at a 1:200 dilution in 1X PBS containing 2% milk powder (PBSM ...
-
CRISPR-SID: identifying EZH2 as a druggable target for desmoid tumors via in vivo dependency mappingbioRxiv - Cancer Biology 2021Quote: ... Antigen retrieval was performed using a PickCell 2100-Retriever (ProteoGenix) in citrate buffer (10 mM citric acid ...
-
bioRxiv - Biochemistry 2021Quote: ... we adopted a FRET-based assay using the substrate 5-FAM-AVLQISGFRK(DABCYL)K (Proteogenix). The assay was performed by mixing 0.05 μM Mpro with different concentrations of substrate (1-128 μM ...
-
bioRxiv - Cell Biology 2021Quote: ... which were subcloned before antibody production (Proteogenix, Schiltigheim, France).
-
bioRxiv - Cell Biology 2021Quote: Binding of anti-Unc5B antibodies to Human or Rat Unc5B was performed using a Biacore™ 8K (Proteogenix, Schiltigheim, France). Human or Rat Unc5B-ECD-Fc (R&D Systems ...
-
bioRxiv - Biochemistry 2021Quote: The peptides were synthesized in solid phase using Fmoc strategy (Proteogenix) encompassing a biotinyl group ...
-
bioRxiv - Biophysics 2021Quote: ... A GlyGlyGlyCys peptide (Proteogenix, Schiltigheim, France), was dissolved in MeOH to 10 mM and added in a 6:1 ratio to 300 μM oligo-maleimide and incubated for 1h at 37°C ...
-
bioRxiv - Plant Biology 2021Quote: ... followed by three copies of the FLAG octapeptide tag coding region (3xFLAG) and driven by the Aspergillus nidulans gpdA promoter and the SV40 late polyadenylation signal was synthesized by ProteoGenix (Schiltigheim, France). Codon-optimization of mClover3 was performed in accordance with F ...
-
bioRxiv - Biochemistry 2021Quote: ... of SARS-CoV-2 (acNLNSSRVPDLLVCOOH) or of it South African mutant P71L (acNLNSSRVLDLLVCOOH) were synthesized in solid phase using the Fmoc strategy (Proteogenix, Schiltigheim, France). Peptides were resuspended in water to prepare stock solutions.
-
bioRxiv - Biochemistry 2021Quote: The lyophilized TOST-1 and PID-1 peptides were purchased from Proteogenix at 95 % purity ...
-
bioRxiv - Molecular Biology 2021Quote: ... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
bioRxiv - Biochemistry 2021Quote: The biotinylated peptide (sequence Biotin-(PEG3)-GFQNTDDVQTSF)(Figure 1C) was synthesized in solid phase using Fmoc strategy (Proteogenix). The sequence encompasses a biotinyl group ...
-
bioRxiv - Biochemistry 2021Quote: The palustrin-Ca peptide (MW=3304 g mol-1, purity >95%) was purchased from ProteoGenix (Paris). 4.5 g of the peptide was dissolved in 0.6 mL of a 50% (v/v ...