Labshake search
Citations for ProteoGenix :
1 - 50 of 118 citations since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Synthetic Biology 2024Quote: ... These candidates were produced using solid-phase synthesis from ProteoGenix.
-
bioRxiv - Cell Biology 2024Quote: ... A discontinuous Nycodenz® (Proteogenix) gradient was then generated and ultracentrifuged (141000 g for one hour at 4°C ...
-
bioRxiv - Immunology 2024Quote: ... Leukocytes were purified by combining polymorphonuclear and mononuclear cell layers using Polymorphprep reagent (ProteoGenix, Schiltigheim, France) at room temperature ...
-
bioRxiv - Biophysics 2024Quote: A biotinylated form of the optimized Abl substrate Abltide (biotin-GGEAIYAAPFKK, obtained from ProteoGenix, France) was incubated in concentrations ranging from 3.125 µM to 200 µM together with 0.1 ng/μl of the respective Abl construct ...
-
bioRxiv - Neuroscience 2024Quote: All peptides were custom synthesized by Proteogenix. A 7.5 mM stock solution in H2O/ACN 1:1 was prepared and kept at -20 °C ...
-
bioRxiv - Biochemistry 2024Quote: ... Rabbit polyclonal anti-PorXPG antibodies were manufacterd by Proteogenix (Schiltigheim, France) using recombinant PorX as an antigen ...
-
bioRxiv - Bioengineering 2024Quote: ... supplemented with Benzonase (Proteogenix, 27 U/mL final) and lysozyme (20 µg/mL) ...
-
bioRxiv - Cell Biology 2024Quote: ... 30 mL of the diluted BM was gently layered over 15 mL of Lymphoprep (ProteoGenix, Cat. 1114544) and centrifuged at 400g for 30 minutes at 20°C ...
-
bioRxiv - Microbiology 2024Quote: ... Polyclonal rabbit primary antibodies against PgPepO and TfPepO were obtained from Proteogenix (Schiltigheim, France). The protein molecular weight standards Precision Plus Protein™ Dual Xtra Prestained Protein Standards and Precision Plus Protein™ Kaleidoscope™ Prestained Protein Standards ...
-
bioRxiv - Biochemistry 2024Quote: ... peptide and derivative hexapeptides were synthesized as Ac-[V;Q;I;V;Y;K]-NH2 form and lyophilized by Proteogenix® ...
-
bioRxiv - Immunology 2024Quote: ... cells were pretreated with 20µM of the inhibitory peptide Ht31 (RRRRRRRRRLIEEAASRIVDAVIEQV) or the control peptide Ht31-P (RRRRRRRRRLIPEAASRPVDAVIEQV) for 1 hour (synthetized by ProteoGenix).
-
β-1,6-glucan plays a central role in the structure and remodeling of the bilaminate fungal cell wallbioRxiv - Microbiology 2024Quote: Rabbit polyclonal antibodies were produced by ProteoGenix (Schiltigheim, France) using pustulan-conjugated BSA as the antigen ...
-
bioRxiv - Molecular Biology 2024Quote: ... 1:1,000), rabbit anti-HA (Cell Signal #C29F4, 1:1,000) and rat anti-EXP1 (custom made from Proteogenix, 1:1,000). Secondary antibodies used ...
-
bioRxiv - Biochemistry 2024Quote: ... a codon-optimized synthetic TgREMIND gene was cloned in a pEGFP-C1 expression vector to express the protein in fusion with an N-terminal GFP (Proteogenix). A stop codon was inserted in the coding sequence of TgREMIND to express the [1-382] region of TgREMIND appended with an N-terminal GFP (GFP-F-BARREMIND) ...
-
bioRxiv - Neuroscience 2024Quote: Lec-bs IgG was purchased from ProteoGenix (Schiltigheim, France). A list of the immunoreagents used in this study is presented in Table 2 ...
-
bioRxiv - Developmental Biology 2024Quote: ... The mouse monoclonal antibody was produced by Proteogenix (Schiltigheim, France) against a 6His-tag (MGSHHHHHHSG ...
-
bioRxiv - Biochemistry 2024Quote: ... A codon-optimized synthetic TgBAR2 gene was cloned in pET-15b plasmid (ProteoGenix) to express the protein with an N-terminal His-tag ...
-
bioRxiv - Neuroscience 2024Quote: Surface Plasmon Resonnance was performed by Proteogenix (19 rue de la Haye ...
-
bioRxiv - Microbiology 2024Quote: ... or an anti-GAPDH polyclonal antibody (Proteogenix, France). Goat anti-rabbit HRP (Pierce ...
-
bioRxiv - Immunology 2024Quote: Neutrophils were isolated from EDTA-anticoagulated blood of healthy controls using Polymorphprep (Proteogenix) and 2*106/ml neutrophils in R10 were incubated with 10 µg/ml IgA in 10 µl for 4 hours at 37 °C ...
-
bioRxiv - Plant Biology 2024Quote: ... Primary LMTP1 and TLP26 antibodies were generated in rabbit against the recombinant protein (ProteoGenix) and used at a 1:5000 ratio ...
-
bioRxiv - Neuroscience 2024Quote: ... pan-Synapsin (Proteogenix, 1:1000), PSD-95 (NeuroMab ...
-
bioRxiv - Microbiology 2024Quote: ... schizonts were harvested using a 55% Nycodenz AG (ProteoGenix) gradient (v/v in RPMI ...
-
bioRxiv - Biochemistry 2024Quote: ... Gab1667-677 and the monophosphorylated peptides pY659-Gab1655-677 and pY659-Gab1655-666 were synthesised by Proteogenix, France ...
-
bioRxiv - Immunology 2024Quote: Monoclonal antibodies (mAbs) reactive with human CCR9 were generated using hybridoma technology (ProteoGenix). Anti-CCR9 antibody-producing hybridomas were generated by immunizing mice with different peptides derived from the human extracellular N-terminal region of human CCR9 fused to a KLH carrier protein to improve stability and the immune response ...
-
bioRxiv - Plant Biology 2024Quote: The wild-type IRT1 (144-185) peptide and the four mutant peptides were synthesized by Proteogenix with a purity grade of 95% minimum ...
-
bioRxiv - Biochemistry 2024Quote: ... Mpro FRET-based substrate 5-FAM-AVLQSGFRK(DABCYL)K (ProteoGenix, Miami, FL, USA)-Commercial human plasma (STA-System Control N+P ...
-
bioRxiv - Bioengineering 2024Quote: ... 1.3 mM GCGPQGIAGQGCG (MMP-cleavable, Proteogenix, >95% purity, TFA removed), 1 mM lithium phenyl-2,4,6- trimethylbenzoylphosphinate (LAP ...
-
bioRxiv - Cancer Biology 2024Quote: ... to which equal volume of 28.7% solution of Nycodenz (ProteoGenix, 1002424) in GBSS - NaCl were added and mixed well ...
-
bioRxiv - Biophysics 2024Quote: Peptides representative of the CaV1.3 and CaV2.1 IQ-domains were N-terminally labeled with a 5-TAMRA fluorophore (CaV1.3: 5-TAMRA-DEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYP-NH2, CaV2.1:_5-TAMRA-TDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQD-NH2; Proteogenix, purity > 95%). Using a previously described 384-well plate-based assay (Brohus et al. ...
-
bioRxiv - Bioengineering 2024Quote: ... 2 mM of CGGRGDSPK-FITC-G (RGD-FITC, Proteogenix, >95% purity, TFA removed), GCGGRGDSPG (RGD ...
-
bioRxiv - Bioengineering 2024Quote: ... GCGGRGDSPG (RGD, Proteogenix, >95% purity, TFA removed), or trimerized (Ac)-GGYGGGPGGPPGPPGPPGPPGPPGFOGERGPPGPPGPPGPPGPPGPC-(Am ...
-
bioRxiv - Bioengineering 2024Quote: ... or trimerized (Ac)-GGYGGGPGGPPGPPGPPGPPGPPGFOGERGPPGPPGPPGPPGPPGPC-(Am) (GFOGER, Proteogenix, >95% purity, TFA removed) were added to the solution or to BSA-NB emulsion ...
-
bioRxiv - Cancer Biology 2024Quote: ... Antigen-specific cancer cell killing by TILs was induced after addition of 1 ng/ml of a bispecific anti-CD3E-EpCAM antibody (ProteoGenix, Schiltigheim, France). After two days ...
-
bioRxiv - Neuroscience 2023Quote: ... was resuspended in 0.25 M sucrose and 51% Nycodenz (ProteoGenix). A 26% ...
-
bioRxiv - Genomics 2023Quote: ... Yeast cells were synchronised in G1 by adding of α-factor (Antibodies-online, ABIN399114 or Proteogenix, WY-13) in the media every 30 min during 2h30 (1µg/mL final).
-
bioRxiv - Immunology 2023Quote: ... naïve T-cells were seeded in 96-well U-bottom together with bone marrow-derived dendritic cells (BMDCs) loaded with the indicated OVA peptide (Proteogenix) at 10 ng/mL or antibodies ...
-
bioRxiv - Cell Biology 2023Quote: ... and TAMRA-AngII were synthesized by Proteogenix. [Sar1 ...
-
ENGRAILED-1 transcription factor has a paracrine neurotrophic activity on adult spinal α-motoneuronsbioRxiv - Neuroscience 2023Quote: ... The peptides (ProteoGenix) were co-injected with hEN1 at a 20-fold molar excess of peptides ...
-
bioRxiv - Microbiology 2023Quote: ... generating a polyclonal antibody against the tyrosine-phosphorylated intracellular portion of BST2 (Proteogenix).
-
bioRxiv - Microbiology 2023Quote: ... cilgavimab biosimilar (PX-TA1033) and sotrovimab biosimilar (without LS) (PX-TA1637) were commercially purchased from Proteogenix. Clinical grade palivizumab was obtained from the Ghent University hospital.
-
bioRxiv - Cell Biology 2023Quote: Synthetic biotinylated peptides were purchased from ProteoGenix, France ...
-
bioRxiv - Molecular Biology 2023Quote: Two peptides spanning two parts of the p53 coding sequence were synthesized by ProteoGenix (Schiltigheim, France): PD74 ...
-
bioRxiv - Microbiology 2023Quote: The full-length PfS1 recombinant purified protein was used to immunized rabbits subcutaneously following a two-months standard procedure (Proteogenix, France). Briefly ...
-
bioRxiv - Microbiology 2023Quote: Blots were incubated with antibodies (1/3000 dilution) purified on G-protein (Proteogenix, France), followed by horseradish peroxidase-conjugated (HRP ...
-
bioRxiv - Microbiology 2023Quote: ... The corresponding genes were synthesized and cloned by ProteoGenix into pet-30a(+ ...
-
bioRxiv - Microbiology 2023Quote: PMNs were isolated from 18 mL venous EDTA-anticoagulated blood from healthy donors using PolymorphPrep (ProteoGenix, Schiltigheim, France) gradient centrifugation at 590 ×g for 30 min ...
-
A pectin-binding peptide with a structural and signaling role in the assembly of the plant cell wallbioRxiv - Plant Biology 2023Quote: ... RALF22R82A,R90A,R100A (AQKKYISYGAMARNSVPCSARGASYYNCQAGAQANPYSRGCSTITRCRR) and RALF22Y75A,Y78A (AQKKAISAGAMRRNSVPCSRRGASYYNCQRGAQANPYSRGCSTITRCRR) peptides were chemically synthesized (ProteoGenix, Schiltigheim, France).
-
bioRxiv - Genetics 2023Quote: ... Yeast cells were synchronized in G1 by adding α-factor (Proteogenix, WY-13) in the media every 30 min during 2h30 (1 μg/mL final) ...
-
bioRxiv - Plant Biology 2023Quote: ... The purified protein was injected in two rabbits for immunization by Proteogenix, to generate PhDEF-directed polyclonal antibodies ...