Labshake search
Citations for Agilent :
101 - 150 of 7375 citations for Mouse Liver Expressed Antimicrobial Peptide 2 LEAP2 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2023Quote: ... Aβ42 was expressed in the Escherichia coli BL21Gold (DE3) strain (Stratagene, La Jolla, CA) and purified by sonication and dissolving the inclusion bodies in 8 M urea ...
-
bioRxiv - Biochemistry 2024Quote: The codon-optimized plasmid for hPLIN1 was expressed in Escherichia coli ArcticExpress (DE3) (Agilent) while codon optimized plasmids hPLIN2 and hPLIN3 were expressed in E ...
-
bioRxiv - Biochemistry 2023Quote: hSirt3102-399 was expressed in E.coli Arctic Express (DE3) cells (Agilent Technologies, Wilmington, DE), as previously described (30) ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: OCR in human liver cells was measured using XFp Extracellular Flux Analyzers (Agilent Seahorse Biosciences). The cells were plated into XFp cell culture mini plates for 24 h ...
-
bioRxiv - Plant Biology 2021Quote: ... reversed phase peptide fractionation for digested peptide solution56 were conducted on an off-line HPLC (1200 series, Agilent Technologies) combining with two J4SDS-2 guard columns (PolyLC ...
-
bioRxiv - Cell Biology 2022Quote: ... and SureSelectXT Mouse Methyl-Seq Reagent Kit (Agilent Catalog # 931052) ...
-
bioRxiv - Molecular Biology 2022Quote: ... or Dako EnVision + TM Peroxidase Mouse Kit (DAKO, Glostrup, Denmark) with 3,3’-diaminobenzidine as substrate ...
-
bioRxiv - Neuroscience 2021Quote: ... Mouse blood was diluted at 1:200 with antibody diluent solution (DAKO, S080983-2) as the primary antibodies for IHC on wildtype mouse brain paraffin sections ...
-
bioRxiv - Neuroscience 2022Quote: ... the slides were exposed to a mouse-specific biotinylated secondary antibody (GV82111-2, Dako) for 15 minutes ...
-
bioRxiv - Microbiology 2019Quote: ... The cells were stained with HAstV mouse monoclonal antibody 8E7 (2 μg/ml DakoCytomation) for 1 hour at room temperature followed by anti-mouse IgG labeled with Alexa Fluor 488 (anti-mouse IgG-Alexa Fluor 488 ...
-
bioRxiv - Cancer Biology 2022Quote: ... followed by HRP-conjugated anti-mouse secondary antibody polymer (EnVision+; Dako-Cat# K400311-2) and visualized by Cy7-tyramide as substrate ...
-
bioRxiv - Cancer Biology 2021Quote: HLA-restriction of antigen recognition was tested in anti-IFN-γ ELISpot using autologous DCs loaded with the relevant peptide or without peptide (negative control) and blocking antibodies against HLA class I and II (both Dako). DCs were incubated with peptides overnight and the next day anti-HLA mABs were added to ELISpot plates for 1 hour prior to the addition of expanded cells at a ratio of 1 DC to 50 expanded cells ...
-
bioRxiv - Cell Biology 2023Quote: ... the HA epitope sequence was inserted immediately 3’ to the signal peptide sequence by site directed mutagenesis using the QuickchangeXL site directed Mutagenesis kit (Agilent) to obtain the following intermediate vector ...
-
bioRxiv - Cell Biology 2024Quote: ... pcDNA3.1zeo+/ nFlag-cmScarlet-hRobo1 was generated by inserting the Flag tag sequence at the N-terminus after the signal peptide sequence of Robo1 with QuikChange II Site-Directed Mutagenesis Kit (Agilent Technologies ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: FFAs in liver tissue were extracted and measured by GC-MS (Agilent 7890 A / 5975 C) according to the method described by Tang et al(26) ...
-
bioRxiv - Genomics 2019Quote: ... Recombinant PA-Tnp protein was expressed in BL21-Gold(DE3) competent cells (Agilent cat # 230132) and purified using nickel beads ...
-
bioRxiv - Biophysics 2020Quote: The hSirt3102-399 was expressed in E.coli Arctic Express (DE3) cells (Agilent Technologies, Wilmington, DE) as per manufacturer’s recommendations ...
-
bioRxiv - Molecular Biology 2022Quote: Recombinant production/purification: The MLucV construct was expressed in BL21-CodonPlus (DE3)-RIPL strain (Agilent) using ampicillin and chloramphenicol as the selection antibiotic ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: The nsp14 and nsp10 proteins were expressed in Escherichia coli BL21-CodonPlus(DE3)-RIL (Stratagene). The bacteria were grown in Luria–Bertani medium supplemented with 50 mg/mL kanamycin at 37 °C to an OD600 of 0.6 ...
-
bioRxiv - Cell Biology 2019Quote: ... Recombinant proteins were expressed using E.coli BL21 (DE3) RIL according to the manufacturer’s protocol (Stratagene). The recombinant fusion proteins were purified via affinity chromatography from bacterial extracts using amylose resin (New England Biolabs ...
-
bioRxiv - Biochemistry 2020Quote: ... The hSirt3,102-399 was expressed in E.coli Arctic Express (DE3) cells (Agilent Technologies, Wilmington, DE) as per manufacturer’s recommendations ...
-
bioRxiv - Cell Biology 2019Quote: ... Proteins were expressed in BL21-CodonPlus (DE3)-RIL Escherichia coli (Agilent Technologies, catalog no. 230245) at 37°C with 0.25 mM IPTG (Isopropyl β-D-1-thiogalactopyranoside ...
-
bioRxiv - Biophysics 2022Quote: ... Aβ40/Aβ42 was expressed in the Escherichia coli BL21Gold (DE3) strain (Stratagene, La Jolla, CA) and purified by sonication and dissolving the inclusion bodies in 8 M urea ...
-
bioRxiv - Plant Biology 2023Quote: ... Substrate proteins were induced and expressed in Escherichia coli BL21 CodonPlus(DE3)-RIL cells (Stratagene) over night at 18°C after induction with 1 mM IPTG ...
-
bioRxiv - Biophysics 2023Quote: Recombinant Pil1 and Pil1-mCherry were expressed in BL21(DE3)pLysS (#200132, Agilent Technologies Inc.) in auto induction LB medium (#AIMLB0210 ...
-
bioRxiv - Neuroscience 2023Quote: ... All other proteins were expressed in Escherichia coli BL21-CodonPlus(DE3)-RIL cells (Agilent Technologies) in LB medium at 16 □ overnight ...
-
bioRxiv - Cell Biology 2023Quote: Bsp1 proteins were expressed overnight at 20°C in BL21 pLysS Gold competent cells (Agilent) using autoinduction LB medium (Formedium) ...
-
bioRxiv - Biochemistry 2019Quote: ... Peptides were purified by OMIX C18 tips (Agilent), dried and redissolved in 30 µl of 0.1% formic acid in water/acetonitrile (98:2 ...
-
bioRxiv - Cell Biology 2021Quote: ... Peptides were purified on Omix C18 tips (Agilent), dried and re-dissolved in 20 µl loading solvent A (0.1% trifluoroacetic acid in water/acetonitrile (ACN ...
-
bioRxiv - Bioengineering 2022Quote: ... Peptides were purified with preparative HPLC (Agilent 1260) with Agilent ZORBAX 300 SB-C18 (9.4 x 250 mm ...
-
bioRxiv - Cell Biology 2021Quote: ... Peptides were purified on Omix C18 tips (Agilent), dried and re-dissolved in 20 µl loading solvent A (0.1% trifluoroacetic acid in water/acetonitrile (ACN ...
-
bioRxiv - Molecular Biology 2021Quote: ... peptides were purified on OMIX C18 Tips (Agilent) which were first washed with pre-wash buffer (0.1% TFA in water/acetonitrile (20:80 ...
-
bioRxiv - Bioengineering 2021Quote: ... Peptides were purified with preparative HPLC (Agilent 1260) and identified by Shimadzu LCMS-2020 ...
-
bioRxiv - Biochemistry 2023Quote: ... peptides were desalted using C18 OMIX tips (Agilent) according to the manufacturer’s protocol ...
-
bioRxiv - Systems Biology 2024Quote: ... and detected by 1:2000 dilution of respective secondary HRP-antibody-conjugates (anti-rabbit, P044801-2, Agilent; anti-mouse, P044701-2, Dako).
-
bioRxiv - Molecular Biology 2021Quote: ... the Quikchange 2 Site-Directed Mutagenesis Kit (Agilent Technologies 210518) was used to introduce the two mutations ...
-
bioRxiv - Biophysics 2020Quote: ... a peptide trap column (OPTI-TRAP for peptides, Optimize Technologies) and a reversed-phase analytical column (PLRP-S for Biomolecules, Agilent Technologies). Pepsin digestion was performed online at a flow rate of 75 µL/min (0.4 % formic acid in water ...
-
bioRxiv - Genomics 2020Quote: ... As described in manufacturer’s protocol (Agilent SureSelectXT Mouse Methyl-Seq Kit), bisulfite converted libraries were PCR-amplified for 8 cycles with supplied universal primers and purified using AMPure XP beads ...
-
bioRxiv - Neuroscience 2022Quote: ... and the Dako Envision Flex Plus Mouse Link Kit (Agilent, USA) to detect the antibody along with the Dako DAB (Agilent ...
-
bioRxiv - Neuroscience 2024Quote: ... and the Dako Envision Flex Plus Mouse Link Kit (Agilent, USA) to detect the antibody along with the Dako DAB (Agilent ...
-
bioRxiv - Neuroscience 2021Quote: ... CD20 (monoclonal mouse – anti-human CD20 IgG2a, clone L26, cat. no. M075501-2, Agilent Technologies), 1:800 ...
-
bioRxiv - Immunology 2021Quote: ... rabbit anti-mouse IgG (1.3 μg ml−1, 5% milk in PBST; Dako, P026002-2) or goat anti-rabbit IgG (250 ng ml−1 ...
-
bioRxiv - Biophysics 2020Quote: The PEDV spike sample expressed in Sf9 cells was analyzed on Zorbax SB-C18 column (Agilent) with water with 0.1% formic acid and acetonitrile with 0.1% formic acid as mobile phases ...
-
bioRxiv - Biophysics 2021Quote: Aβ42 (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) was expressed recombinantly in the Escherichia coli BL21 Gold (DE3) strain (Stratagene, CA, USA), and purified as described previously15 ...
-
bioRxiv - Neuroscience 2020Quote: GST-NT and GST-NT-ABmut were expressed in BL21-CodonPlus (DE3)-RIPL cells (Agilent, 230280), purified as described previously (Fujiwara et al. ...
-
Mechanical forces impair antigen discrimination by reducing differences in T cell receptor off-ratesbioRxiv - Immunology 2022Quote: ... TCR α and β chains were expressed in BL21 (DE3)-RIPL Escherichia coli cells (Agilent Technologies) following induction with 0.15 mM IPTG ...
-
bioRxiv - Neuroscience 2019Quote: ... Recombinant proteins were expressed in BL21-CodonPlus (DE3)-RILP Competent Cells (Agilent Technologies, Santa Clara, CA) and purified using Glutathione Sepharose 4B Media (GE Healthcare ...
-
bioRxiv - Neuroscience 2020Quote: ... All recombinant proteins were expressed in the BL21-Gold (DE3) pLysS strain of Escherichia coli (Agilent) in pGEX-KG vectors as glutathione S-transferase (GST ...
-
bioRxiv - Biophysics 2023Quote: GST-His9-SARS-CoV2 RBDL Nucleocapsid construct was expressed recombinantly in Gold BL21(DE3) cells (Agilent). 4 L cultures were grown in LB medium with carbenicillin (100 ug/mL ...
-
bioRxiv - Microbiology 2020Quote: ... of sample was loaded via the autosampler onto a C18 peptide column (AdvanceBio Peptide 2.7 um, 2.1 x 150 mm, Agilent part number 653750-902) enclosed in a thermostatted column oven set to 50 °C ...