Labshake search
Citations for Thermo Fisher :
3451 - 3500 of 5129 citations for TAGAP Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Genomics 2022Quote: Peptide samples were solubilized in 0.1% formic acid and fractionated using a nano-LC Easy 1000 system (Thermo Fisher) coupled to an Orbitrap-type mass spectrometer (Q Exactive Plus ...
-
bioRxiv - Neuroscience 2022Quote: ... The peptide samples were analysed on an LTQ-OrbitrapXL mass spectrometer Kit (Thermo Fisher Scientific, Rock ford, IL, USA) coupled to the Eksigent nanoLC-Ultra® 2D system (AB Sciex ...
-
Multiomic Approach Characterises the Neuroprotective Role of Retromer in Regulating Lysosomal HealthbioRxiv - Neuroscience 2022Quote: ... peptides in 1% (vol/vol) formic acid were injected onto an Acclaim PepMap C18 nano-trap column (Thermo Scientific). After washing with 0.5% (vol/vol ...
-
bioRxiv - Neuroscience 2022Quote: ... The peptides obtained were extracted with 50 mM AmBic buffer and dried with a SpeedVac (Thermo Fisher Scientific, USA) and stored at −80 °C prior to quantitative and qualitative analyses by shotgun mass spectrometry (MS) ...
-
bioRxiv - Plant Biology 2022Quote: ... Peptides were analyzed by MS as follows: a 1 μL injection was made onto a C8 trap column (ThermoFisher, μ-precolumn – 300 μm i.d ...
-
bioRxiv - Plant Biology 2022Quote: ... Analysis of the eluted tryptic peptides was performed online using a Q Exactive™ Plus mass spectrometer (Thermo Scientific) possessing a Nanospray Flex™ Ion source (Thermo Fisher ...
-
bioRxiv - Plant Biology 2022Quote: Peptides were eluted at 300 nL/min from a 75 μm x 50 cm PepMap C18 column (Thermo Scientific) using the following gradient ...
-
bioRxiv - Cancer Biology 2022Quote: Peptide mass spectra were acquired using either Orbitrap Fusion Lumos or Orbitrap Eclipse Tribrid mass spectrometer (Thermo Fisher Scientific) with MS1 Orbitrap resolution of 240000 and MS/MS fragmentation of the precursor ions by collision-induced dissociation (CID ...
-
bioRxiv - Microbiology 2022Quote: The concentration of peptide stock solution was determined by absorption measurement at 205 nm using a Nanodrop instrument (ThermoFisher), and confirmed using a Pierce(tm ...
-
bioRxiv - Immunology 2022Quote: ... 750,000 PBMCs were incubated either with DMSO (negative control) or with 9-mer and 15-mer peptides in 0.5 ml RPMI (Gibco) +10% Human AB serum (Sigma ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... Eluting peptides were on-line ionized by nano-electrospray (nESI) using the Nanospray Flex Ion Source (Thermo Fisher Scientific) at 1.5 kV (liquid junction ...
-
bioRxiv - Cancer Biology 2022Quote: ... Peptides were loaded onto a C18 trap column (Acclaim PepMap, 100 A 5 µm particle size, Thermo Fisher Scientific) at a flow rate of 5 µL/min in Solvent A (0.1% formic acid in water ...
-
bioRxiv - Cell Biology 2022Quote: ... This combined sample was then subjected to fractionation using the high pH reversed-phase peptide fractionation kit (Thermo Fisher) for a final of six fractions for the nuclear eluates ...
-
bioRxiv - Neuroscience 2024Quote: ... Measurements of peptide library fractions were performed on a quadrupole-ion-trap-orbitrap MS (Orbitrap Fusion, Thermo Fisher Scientific) in orbitrap-orbitrap configuration ...
-
bioRxiv - Systems Biology 2024Quote: DISPA of the plasma proteome peptides was performed on an Orbitrap Fusion Lumos™ mass spectrometer (Thermo Fisher Scientific) coupled with the FAIMS Pro Interface ...
-
bioRxiv - Bioengineering 2024Quote: ... Peptides were then analysed on a Ultimate 3500 RSLCnano system (Dionex) and a Q-Exactive HF (Thermo Fisher Scientific) mass spectrometer ...
-
bioRxiv - Plant Biology 2024Quote: ... Eluting peptides were on-line ionized by nano-electrospray (nESI) using the Nanospray Flex Ion Source (Thermo Fisher Scientific) at 1.5 kV (liquid junction ...
-
bioRxiv - Microbiology 2024Quote: ... Peptides were separated using a 140 min gradient generated by an EASY-nLC 1000 liquid chromatography (Thermo Fisher Scientific) with the column heated to 50 °C by a PRSO-V1 column oven (Sonation) ...
-
bioRxiv - Cell Biology 2023Quote: The fractionated peptides were analysed by LC-MS/MS using a fully automated Ultimate 3000 RSLC nano System (ThermoFisher) fitted with a 100 μm x 2 cm PepMap100 C18 nano trap column and a 75 μm×25 cm ...
-
bioRxiv - Physiology 2024Quote: ... Approximately 7 µg of tryptic peptide from each tissue sample was labeled with TMT-Pro 16 plex (Thermo Scientific) reagents according to the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2024Quote: ... Peptide separation was performed using a reversed-phase analytical column (Acclaim PepMap RSLC, 0.075 × 250 mm (Thermo Fisher Scientific)) with a linear gradient of 4-27.5% solvent B (0.1% FA in 98% ACN ...
-
bioRxiv - Genomics 2024Quote: ... Desalted peptides were labeled with the TMT-10plex mass tag labeling reagent according to the manufacturer’s instructions (Thermo Scientific) with small modifications ...
-
bioRxiv - Neuroscience 2024Quote: ... Quantification of histone peptides were performed in nanoLC coupled online to an LTQ-Orbitrap Elite mass spectrometer (Thermo Scientific). About 1-5 μg of desalted samples were then separated using a 75 μm ID x 17 cm Reprosil-Pur C18-AQ (3 μm ...
-
bioRxiv - Biophysics 2023Quote: The PUR4 (also known as FUD) peptide (sequence: KDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNMVETEDT) and the scrambled control (sequence: EKGYSKPPVGNEGGDQVDEYDTMSQTKLEDEGNTLISPITFENATEQVN) were synthesised by ThermoFisher Scientific without any tags or modifications ...
-
bioRxiv - Cell Biology 2023Quote: ... The eluted peptides were sprayed into a LTQ Orbitrap Velos mass spectrometer (Thermo Fisher Scientific, San Jose, CA, USA) equipped with a nano-ESI ion source ...
-
bioRxiv - Microbiology 2023Quote: ... the peptides were resuspended in 0.1% (v/v) formic acid and desalted using C18 Zip tips (Pierce, Thermo Scientific). The peptides were again dried by vacuum centrifugation before being reconstituted in 50 µL of 0.1% (v/v ...
-
bioRxiv - Biochemistry 2024Quote: Peptide samples were dissolved in 0.1% FA and analyzed on the Orbitrap Eclipse Tribrid Mass spectrometer (Thermo Fisher Scientific) coupled to an Easy-nLC 1200 HPLC system (Thermo Fisher Scientific) ...
-
bioRxiv - Microbiology 2024Quote: ... Peptides were trapped on a C18 Acclaim PepMap 100 (5 µm, 300 µm x 5mm) trap column (ThermoFisher Scientific) and eluted onto a C18 Acclaim PepMap100 3 µm ...
-
bioRxiv - Immunology 2024Quote: TMT-labelled tryptic peptides were subjected to HpRP fractionation using an Ultimate 3000 RSLC UHPLC system (Thermo Fisher Scientific) equipped with a 2.1 mm internal diameter (ID ...
-
bioRxiv - Microbiology 2024Quote: ... We quantified the abundance of the peptides using the Pierce Micro BCA assay (Thermo Scientific Pierce, Rockford, IL, USA) following the manufacturer’s instructions.
-
bioRxiv - Bioengineering 2023Quote: The peptide digests were subjected to LC MS/MS analysis using an UltiMate 3000 RSLC system (Thermo Fisher Scientific) coupled in-line to an Orbitrap Fusion Lumos mass spectrometer (Thermo Fisher Scientific) ...
-
Ribonuclease Inhibitor and Angiogenin collaboratively regulate cell-type-specific global translationbioRxiv - Biochemistry 2024Quote: ... Peptides were trapped on a micro-precolumn C18 PepMap100 (5μm, 100 Å, 300 μm×5mm, ThermoFisher Scientific, Reinach, Switzerland) and separated by backflush onto the analytical nano-column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... Samples were injected onto a 300μm x 5mm PepMap Neo Trap Cartridge peptide trap column (C18, 5μm particle size, 100Å pore size, ThermoFisher Scientific) and separated on an EASY-Spray 75μm x 50cm PepMap HPLC column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... Samples were injected onto a 300μm x 5mm PepMap Neo Trap Cartridge peptide trap column (C18, 5μm particle size, 100Å pore size, ThermoFisher Scientific) and separated on an EASY-Spray 75μm x 50cm PepMap HPLC column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... 75 µm x 50 cm) and peptides then analysed using an Orbitrap Eclipse Tribrid mass spectrometer (Thermo Fisher Scientific). Solvent A comprised 0.1% formic acid (v/v ...
-
bioRxiv - Cancer Biology 2024Quote: ... Each peptide extract was loaded on a 300 μm ID x 5 mm PepMap C18 precolumn (Thermo Scientific, USA) at a flow rate of 10 μL/min ...
-
bioRxiv - Biochemistry 2023Quote: ... Eluted peptides were analysed by using an Orbitrap Fusion Lumos Tribrid Mass Spectrometer (Thermo Fisher Scientific, Waltham, MA, USA).
-
bioRxiv - Biochemistry 2023Quote: ... 1.5 µg of peptide was analysed on the Exploris 480 coupled with a Dionex Ultimate 3000 RS (Thermo Scientific). LC buffers prepared as follows ...
-
bioRxiv - Microbiology 2023Quote: ... peptide quantitative features were extracted from LC-MS files using SIEVE (v2.2, Thermo Fisher Scientific, San Jose, CA, USA) and processed by the UHR-IonStar APP to generate final quantification results ...
-
bioRxiv - Molecular Biology 2022Quote: The peptide samples were analysed on a nano liquid chromatography system (Ultimate 3000 nano HPLC system, Thermo Fisher Scientific) coupled to an Orbitrap Exploris 240 mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Peptide separation was performed using a reversed-phase analytical column (Acclaim PepMap RSLC, 0.075 x 250 mm, Thermo Scientific) with a linear gradient of 4%-27.5% solvent B (0.1% FA in 98% ACN ...
-
bioRxiv - Molecular Biology 2023Quote: ... The desalted peptides were labeled with the TMT11plex mass tag labeling reagent according to the manufacturer’s instructions (ThermoFisher Scientific) with small modifications ...
-
bioRxiv - Biochemistry 2022Quote: The peptide samples were analyzed on a nano liquid chromatography system (Ultimate 3000 nano HPLC system, Thermo Fisher Scientific) coupled to an Orbitrap Exploris 240 mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Cancer Biology 2023Quote: Peptides from 833 µm resolution samples were analysed by LC-MS/MS using a Dionex Ultimate 3000 (Thermo Scientific) coupled to a timsTOF Pro (Bruker ...
-
bioRxiv - Microbiology 2023Quote: ... Peptide samples were loaded onto a 75 µm x 2 cm Acclaim PepMap 100 C18 trap column (Thermo Scientific) in 0.1% formic acid ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... The peptide ions were detected under the data-dependent acquisition mode using the installed Xcalibur software (Thermo Fisher Scientific). Full-scan mass spectra were acquired in the range of 375-1,500 m/z with resolution of 70,000 ...
-
bioRxiv - Genomics 2022Quote: ... Peptide fractions were analyzed using the Orbitrap Fusion MS coupled to a Dionex Ultimate 3000 nHPLC system (Thermo Fisher Scientific Inc. ...
-
bioRxiv - Cell Biology 2022Quote: ... the LePin peptides are coupled to an affinity column with SulfoLink® Immobilization Kit (Thermo Scientific™, Cat. 44995) according to the manufacturer’s manual ...
-
bioRxiv - Cancer Biology 2023Quote: ... Peptides were online desalted on a trapping cartridge (Acclaim PepMap300 C18, 5 μm, 300Å wide pore, Thermo Fisher Scientific) for three minutes using 30 uL/min flow of 0.05% TFA in water ...
-
bioRxiv - Molecular Biology 2023Quote: ... Identifications and retention times were used to guide the manual quantification of each modified peptide using QualBrowser version 2.0.7 (Thermo Scientific). Site assignment was evaluated from MS2 spectra using QualBrowser and MaxQuant Viewer ...