Labshake search
Citations for Thermo Fisher :
301 - 350 of 10000+ citations for CKLF Like MARVEL Transmembrane Domain Containing 7 CMTM7 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... The caspase-3/7 activity assay contained CellEvent Caspase- 3/7 Green Detection Reagent (Thermo Fisher, C10723) at a final ...
-
bioRxiv - Biochemistry 2021Quote: ... The chemically synthesized p53 TAD2 domain peptide (38QAMDDLMLSPDDIEQWFTEDPGPD61) was obtained with >90% purity from Thermo Scientific, USA ...
-
bioRxiv - Plant Biology 2020Quote: ... A Y2H prey library of Arabidopsis NTL proteins fused to the GAL4 activation domain (pDEST22; Invitrogen) was similarly created and transformed into the opposite yeast mating strain ...
-
bioRxiv - Developmental Biology 2020Quote: Robo1 domain deletions were generated via site-directed mutagenesis using Phusion Flash PCR MasterMix (Thermo Scientific), and completely sequenced to ensure no other mutations were introduced ...
-
bioRxiv - Immunology 2022Quote: Sequences for VH and VL domains were codon optimized using GeneArt (Thermo Fisher Scientific, Waltham, MA) and gene blocks for each domain were purchased from Integrated DNA Technologies (IDT ...
-
bioRxiv - Microbiology 2023Quote: ... followed by an incubation with mouse anti-human E-cad cytoplasmic domain mAb (4A2C7, Life Technologies). In some experiments ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Neuroscience 2023Quote: ... or lacking the CTLH (ΔCTLH) and LISH (ΔLISH) domain were cloned by the Gateway® (Invitrogen) method into pDONR221 entry vector and then recombined into a yeast low-copy number CEN destination vector (Addgene ...
-
bioRxiv - Cancer Biology 2021Quote: ... Supernatant was collected for 7 days and the antibody was purified using a protein A column (ThermoFisher Scientific, 89960; IL). The original murine anti-PD1 monoclonal antibody (63 ...
-
bioRxiv - Biochemistry 2021Quote: ... Proteins were transferred onto a nitrocellulose membrane and analyzed by western blotting using an anti-His tag antibody (7) or stained with Krypton fluorescent dye (ThermoFisher) according to a company’s instruction ...
-
bioRxiv - Biochemistry 2023Quote: ... Cells were then washed and stained for 20 min at 4 °C with the following antibodies: anti-mouse CD8α APC-efluo780 (clone 53-6-7, ebioscience/ Thermofisher), anti-mouse CD8β AF700 or BUV495 (clone YTS156 ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... we first extracted total RNA from pools of tissue derived from ten like individuals using TRIzol Reagent (Invitrogen, Carlsbad, CA) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2020Quote: ... it was necessary to use a fluorescent DNA quantification method with high sensitivity like the Qubit dsDNA HS kit (Invitrogen). Quality assessment ...
-
bioRxiv - Biochemistry 2020Quote: ... Further sub-cloning of ZmGl2 and ZmGl2-like sequences for plant expression experiments were performed using LR Clonase II Enzyme Mix (Invitrogen), using pEarleyGate100 vector (Earley et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... transfected (psDsRed-2Mito) striatal-like neurons in coverslips were washed with Hanks’ Balanced Salt solution (HBSS) (#14025, Thermo Fisher Scientific). Mitochondrial movement videos were acquired on a Zeiss Cell Observer Spinning Disk System (Carl Zeiss Microscopy) ...
-
bioRxiv - Microbiology 2022Quote: ... WTC hiPSCc were passaged as small clumps for maintenance or single cell-like suspension for cardiac differentiation using Versene (Gibco) and mTeSR Plus supplemented with 10 μM Y-27632 (Tocris) ...
-
bioRxiv - Bioengineering 2022Quote: Human iPSC-derived Brain Microvascular Endothelial-like cells were treated with 25 μg/mL fluorescent transferrin conjugate (Thermo Fisher Scientific) and incubated at 37oC for 30 min ...
-
bioRxiv - Bioengineering 2020Quote: ... the cell instructive LEGO-like scaffolds were prepared by loading microgels supplemented with 10 µg/mL of rhVEGF165 (Invitrogen, ThermoFisher) and PDGF-BB (R&D Systems ...
-
bioRxiv - Bioengineering 2020Quote: ... the cell instructive LEGO-like scaffolds were prepared by loading microgels supplemented with 10 µg/mL of rhVEGF165 (Invitrogen, ThermoFisher) and PDGF-BB (R&D Systems ...
-
bioRxiv - Microbiology 2022Quote: Murine macrophage-like RAW 264.7 cells and human A549 lung epithelial carcinoma cells were cultivated in RPMI 1640 medium (Life Technologies) supplemented with 10% heat-inactivated fetal bovine serum (FBS ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... were chosen for this study due to the absence of endogenous ASIC-like currents [53] and were grown using standard procedures in the following medium: Ham’s F-12 Nutrient Mixture (Life Technologies), 10 % fetal bovine serum (Sigma) ...
-
bioRxiv - Biochemistry 2019Quote: ... ATCC CCL-2) cells and 3T3-L1 (murine embryo fibroblast-like cells, ATCC CL-173) were grown in DMEM (Gibco) supplemented with 10% FBS (Sigma) ...
-
bioRxiv - Plant Biology 2022Quote: ... Like samples were combined into a single tube then quantified by high sensitivity DNA Qubit (ThermoFisher scientific, Cat. No. Q32854).
-
bioRxiv - Cell Biology 2023Quote: ... Fms-like tyrosine kinase 3 ligand (Flt3- ligand; 100 ng/mL) and 1% penicillin-streptomycin (GIBCO, Grand Island, NY, USA), in the presence or absence of G-CSF at a dose of 100 ng/mL ...
-
bioRxiv - Animal Behavior and Cognition 2023Quote: ... For both fungi, first we obtained fresh blastospores (i.e., yeast-like single cells) suspended in Grace’s Insect Medium (Gibco, Thermo Fisher Scientific) supplemented with 2.5% FBS (Gibco ...
-
bioRxiv - Immunology 2023Quote: Human embryonic kidney (HEK) epithelial-like cell line HEK293T was maintained in Dulbecco’s Modified Eagle’s Medium (DMEM) (11965-118; GIBCO™, Thermo Fisher Scientific ...
-
bioRxiv - Physiology 2023Quote: ... resuspended in extracellular-like Ca2+-free buffer (120mM NaCl; 5mM KCl; 1mM KH2PO4; 0.2mM MgCl2·6H2O (Fisher Scientific #M35-500); 0.1mM EGTA ...
-
bioRxiv - Physiology 2023Quote: Total RNA was extracted from cryo-pulverized liver tissue and hiPSC-derived hepatocyte-like cells using Trizol (Thermo Fisher Scientific) and 1 ug RNA was reverse-transcribed using SuperScriptTM IV VILOTM Master Mix (#11756050 ...
-
bioRxiv - Immunology 2020Quote: ... The sorted germinal centre B cells (7-AAD−/B220+/GL-7+/Fas+) were digested with Proteinase K (Invitrogen) at 55°C overnight ...
-
bioRxiv - Cell Biology 2022Quote: ... 110 nm ultrathin cryosections were collected on 7×7 mm silicon wafers with fluorescent beads (PS-Speck, ThermoFisher). Light microscopy images were acquired with a widefield microscope ...
-
bioRxiv - Neuroscience 2021Quote: ... followed by a 2 hour room temperature incubation in 10% NGS/90% antibody buffer containing the following fluorescently-conjugated secondary antibodies: Goat anti-mouse Alexa 488 (1:500; Invitrogen) and goat anti-rabbit Alexa 594 (1:500 ...
-
bioRxiv - Microbiology 2023Quote: ... Cells were washed in PBS and incubated in primary antibody solution containing astrovirus capsid monoclonal antibody 8e7 (Invitrogen MA5-16293) at 1:100 in 1% NGS/PBS for 1 hour at room temperature ...
-
bioRxiv - Neuroscience 2022Quote: ... Samples were then washed 3 times with Tween20 solution before a 1 h incubation with secondary antibody solution containing goat anti-mouse antibodies conjugated to AlexaFluor 647 (ThermoFisher), goat anti-rabbit antibodies conjugated to AlexaFluor 488 (ThermoFisher) ...
-
bioRxiv - Cell Biology 2023Quote: ... the cells were incubated with a secondary antibody solution containing goat anti-mouse secondary antibody conjugated with Alexa Fluor 488 (1:1,000; Cat. #: A32723, Invitrogen, USA) and donkey anti-rabbit secondary antibody conjugated with Alexa Fluor 647 (1:1000 ...
-
bioRxiv - Developmental Biology 2023Quote: ... Sections were then washed PBS and then incubated for 1 h at room temperature with secondary antibody solution containing 5% goat serum in PBS and the appropriate secondary antibodies conjugated to Mouse-555 (Invitrogen, Waltham ...
-
bioRxiv - Physiology 2024Quote: ... sections were incubated overnight at 4°C in primary antibody solution containing 10% goat serum and antibodies against laminin β1 (1:100; MA5-14657, Invitrogen) or laminin β1γ1 (1:200 ...
-
bioRxiv - Cell Biology 2020Quote: ... using the ViiAtm 7 platform (Applied Biosystems). Relative quantification was conducted by either SYBRgreen fluorescent dye (Applied Biosystems ...
-
bioRxiv - Cell Biology 2019Quote: ... 7 kDa cut-off (Thermo Scientific, #89890). The protein concentration was adjusted to 0.5 mg/ml in CD buffer (250 μL) ...
-
bioRxiv - Genomics 2020Quote: ... 7 mM MgCl2 (Ambion, Cat. No. AM9530G), 10% N,N-dimethylformamide (Sigma ...
-
bioRxiv - Immunology 2022Quote: ... on the ViiA 7 system (Applied Biosystems). PCR of CD19 was used for normalization ...
-
bioRxiv - Immunology 2022Quote: ... on the ViiA 7 system (Applied Biosystems) as described (62 ...
-
bioRxiv - Molecular Biology 2021Quote: ... 7 µL HinFI (10U/µL, Thermo Scientific)) per 70 µL of cDNA and digested at 37°C for 30 minutes ...
-
bioRxiv - Microbiology 2020Quote: ... and a QuantStudio 7 Flex (Life Technologies) instrument ...
-
bioRxiv - Microbiology 2021Quote: ... QuantStudio 6/7 Pro systems (Applied Biosystems). The following primers were used ...
-
bioRxiv - Neuroscience 2020Quote: ... with a ViiA 7 System (Applied BioSystems). The UBE2D2 gene transcript was used as the internal reference ...
-
bioRxiv - Systems Biology 2021Quote: ... and 1:1000 7-AAD (ThermoFisher Scientific). Mouse IgG2A-488 (R&D systems ...
-
bioRxiv - Microbiology 2020Quote: ... and a QuantStudio 7 Flex (Life Technologies) instrument for Il17a (96) ...
-
bioRxiv - Immunology 2022Quote: ... and 7-AAD (Invitrogen, 00-6993-50). CD19/CD20+ ...
-
bioRxiv - Neuroscience 2022Quote: ... Potassium Chloride (Fisher Scientific- 7447-40-7) and Calcium chloride (Fisher Scientific- 10043-52-4).
-
bioRxiv - Neuroscience 2022Quote: ... for 7 days in Neurobasal medium (Invitrogen) with 2% B-27 supplement (Invitrogen) ...