Labshake search
Citations for Thermo Fisher :
2451 - 2500 of 5130 citations for RFC1 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... and the resultant tryptic peptides were labeled with acetonitrile-dissolved TMT reagents (Thermo Scientific, Rockford, IL), and equal amounts of labeled samples were mixed before prefractionation with reversed phase (RP)-high performance liquid chromatography (HPLC) ...
-
bioRxiv - Cell Biology 2023Quote: Immunoprecipitated protein complex beads were digested into peptides using 500ng sequencing grade trypsin (Thermo Fisher Scientific) and incubated overnight at 37°C on a shaker ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Genetics 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
Lactylation-driven FTO-mediated m6A modification of CDK2 aggravates diabetic microvascular anomaliesbioRxiv - Cell Biology 2023Quote: ... Peptides were then labeled with TMT using a TMT10plex mass tag labeling kit (Thermo Fisher Scientific) per the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides were trapped onto a C18 PepMac100 precolumn (300 µm i.d.x5 mm, 100 Å, ThermoFisher Scientific) using Solvent A (0.1% Formic acid ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides were labeled using 100 ug of 16-plex tandem mass tag (TMTpro) reagents (Thermo Fisher), with incubation for 60 min at 22 °C ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides separated by LC were introduced into the Q Exactive HF Orbitrap mass spectrometer (ThermoFisher Scientific) using positive electrospray ionization at 2000 V and capillary temperature of 275°C ...
-
bioRxiv - Cell Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Cell Biology 2023Quote: All peptide samples were separated with an online nanoflow Proxeon EASY-nLC system (Thermo Fisher Scientific) and analyzed on an Orbitrap Lumos mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Plant Biology 2023Quote: Peptide and phosphopeptide samples were analyzed by LC-MS/MS on an RSLCnano system (ThermoFisher Scientific) coupled to a Q-Exactive HF mass spectrometer (ThermoFisher Scientific) ...
-
bioRxiv - Immunology 2023Quote: ... Eluting peptides were injected directly into the mass spectrometer using an EASY-Spray source (Thermo Scientific). The instrument was operated in data-dependent mode with parent ion scans (MS1 ...
-
bioRxiv - Plant Biology 2023Quote: ... Peptides were eluted from a 75 μm x 50 cm C18 analytical column (PepMan, Thermo Scientific) on a linear gradient running from 4 to 64% acetonitrile in 240 min and sprayed directly into the Q-Exactive mass spectrometer ...
-
bioRxiv - Zoology 2023Quote: ... Peptides produced by protease digestion were separated with a Thermo UltiMate 3000 UHPLC (Thermo Fisher Scientific) using a 5–80% effective gradient with mobile phase B (98% acetone ...
-
bioRxiv - Systems Biology 2023Quote: ... The digested peptides were labeled with 11-plex TMT reagents following the manufacturer’s instructions (Thermo Scientific). MP was labeled by TMT channel 131C ...
-
bioRxiv - Systems Biology 2023Quote: ... The eluted solution containing peptides was vacuum-dried with a Savant SPD121P SpeedVac concentrator (Thermo Scientific). The digested peptides were labeled with 11-plex TMT reagents following the manufacturer’s instructions (Thermo Scientific) ...
-
bioRxiv - Developmental Biology 2023Quote: ... Separated peptides were electrosprayed and analyzed using a Q-Exactive HF mass spectrometer (Thermo Fisher Scientific), operated in positive polarity in a datadependent mode ...
-
bioRxiv - Immunology 2023Quote: ... Peptides were trapped on precolumn (PepMap100 C18 3 μm; 75 μm × 2 cm; Thermo Fisher Scientific) and separated on an EASY-Spray column (Thermo Fisher Scientific) ...
-
bioRxiv - Immunology 2023Quote: ... Peptides were loaded on a trap column (Acclaim PepMap 100, 100 µm x 2cm, Thermo Scientific) using combined control with a loading volume of 20 µL ...
-
bioRxiv - Biochemistry 2023Quote: ... 48 h after the peptide treatment 10 % (v/v) of alamarBlue reagent (Thermo Fisher Scientific, #DAL1100) was added to each well and incubated for 4 h at 37°C ...
-
bioRxiv - Molecular Biology 2023Quote: Phosphopeptides were then fractionated using a Pierce high pH reverse-phase peptide fractionation kit (Thermo Fisher) based on (38) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Tryptic peptide analysis was performed using an Orbitrap Fusion Lumos Tribid mass spectrometer (Thermo Fisher Scientific) interfaced with an Ultimate 3000 Nano-HPLC (Thermo Fisher Scientific) ...
-
bioRxiv - Plant Biology 2023Quote: ... Eluted peptides were sprayed directly into an LTQ-Orbitrap Fusion Tribrid mass spectrometer (Thermo Fisher Scientific). Scans were collected in data-dependent top-speed mode of a 3-second cycle with dynamic exclusion set at 60 sec ...
-
bioRxiv - Microbiology 2023Quote: Pooled samples were fractionated using the Pierce™ High pH Reversed-Phase Peptide Fractionation Kit (ThermoFisher Scientific ...
-
bioRxiv - Microbiology 2023Quote: ... Peptide concentrations were measured using the Invitrogen Qubit protein assay kit (Thermo Fisher Scientific, Darmstadt, Germany).
-
bioRxiv - Immunology 2023Quote: Analysis of peptide readout was performed on a Q Exactive™ plus Mass Spectrometer (Thermo Scientific) coupled to a Dionex Ultimate 3000 RS (Thermo Scientific) ...
-
bioRxiv - Biochemistry 2023Quote: ... Peptide samples were dissolved in 0.1% (v/v) formic acid (FA, Thermo Fisher Scientific, LS118-4) for MS analysis ...
-
bioRxiv - Biochemistry 2023Quote: ... Aliquots containing 10 μg of digested peptides were cleaned using PierceTM C18 Spin Tips (Thermo Scientific) according to the manufacturer’s protocol ...
-
bioRxiv - Biophysics 2023Quote: ... peptides were loaded onto a C18 analytical column (1 mm i.d. × 50 mm, Thermo Fisher Scientific) connected to an Agilent 1290 Infinity II UHPLC system ...
-
bioRxiv - Neuroscience 2023Quote: ... The eluting peptides were analyzed on a Quadrupole Orbitrap hybrid mass spectrometer (QExactive; Thermo Fisher Scientific). Here ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (PepMap C18 ...
-
bioRxiv - Cancer Biology 2023Quote: ... The peptides from each sample were labeled with individual Tandem Mass Tags (TMT) (Thermo Fisher Scientific) as previously described50 ...
-
bioRxiv - Developmental Biology 2024Quote: ... and serially diluted with enzyme buffer before ATP and fluorescein-conjugated PKC substrate peptide (ThermoFisher Scientific) were added and incubated ...
-
bioRxiv - Molecular Biology 2024Quote: ... eluted peptides were analyzed on a Q Exactive HF-X Orbitrap mass spectrometer (Thermo-Fisher Scientific), which was coupled to the column with a customized nano-spray EASY-Spray ion source (Thermo-Fisher Scientific ...
-
bioRxiv - Neuroscience 2024Quote: ... The eluted peptides were further injected into an Orbitrap Exploris 480 (Thermo Fisher Scientific, Bremen, Germany), where MS1 scans were acquired in the range of 300–1700 m/z and with a maximum injection time of 40 ms ...
-
bioRxiv - Neuroscience 2024Quote: ... The eluted peptides were further injected into a QExactive HF-X (Thermo Fisher Scientific, Bremen, Germany), operated in data-dependent acquisition mode alternating between MS and MS2 acquisitions ...
-
bioRxiv - Neuroscience 2024Quote: ... The eluted peptides were further injected into an Orbitrap Exploris 480 (Thermo Fisher Scientific, Bremen, Germany), which was operated in targeted mass acquisition mode switching between MS1 and targeted MS2 scans ...
-
bioRxiv - Molecular Biology 2024Quote: ... The digested peptides were analyzed with an EASY nano-LC 1200 system (Thermo Scientific, Milano, Italy) coupled to a 5600+ TripleTOF system (AB Sciex ...
-
bioRxiv - Microbiology 2024Quote: ... Peptide separation was carried out using an Ultimate 3000 nanoLC-system (Thermo Fisher Scientific, Waltham, USA), equipped with an in-house packed C18 resin column (Magic C18 AQ 2.4 µm ...
-
bioRxiv - Microbiology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 200 cm µPAC column (PharmaFluidics) ...
-
bioRxiv - Cell Biology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 200 cm µPAC column (PharmaFluidics ...
-
bioRxiv - Cell Biology 2024Quote: ... Phosphorylated peptides were enriched either using the High-Select Fe-NTA Phosphopeptide Enrichment Kit (Thermo Scientific) or the Titansphere Phos-TiO Kit (GL Science ...
-
bioRxiv - Plant Biology 2024Quote: ... Final peptide concentrations were determined using a bicinchoninic acid (BCA) assay (Thermo Scientific, Waltham, MA USA) and each sample was prepared at 0.1 µg/µl for MS analysis Digested protein samples were analyzed using an Orbitrap Eclipse Tribrid MS (Thermo Scientific ...
-
bioRxiv - Systems Biology 2024Quote: ... Cross-linked peptides from SCX fractions were further enriched using UltraLink monomeric avidin (Thermo Fisher Scientific). The enriched cross-linked peptide sample was concentrated by vacuum centrifugation and stored at -80 °C.
-
bioRxiv - Molecular Biology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 200 cm µPAC column (PharmaFluidics) ...
-
bioRxiv - Cell Biology 2020Quote: ... were blocked (5% nonfat milk) prior to incubation with primary antibodies diluted in Superblock blocking reagent (Thermo Scientific). Binding was detected by incubation with HRP coupled secondary antibodies (1:10000 ...
-
bioRxiv - Developmental Biology 2021Quote: ... the cells were incubated with secondary antibodies (1: 500 dilution in blocking buffer, Alexa Fluor 488, Life Technologies) at room temperature for 1 hour in the dark ...
-
bioRxiv - Neuroscience 2021Quote: ... and primary antibodies applied overnight in blocking medium (Cx36, Thermofisher 51-6300, RRID: AB_2533913, 1:1000; NMDAR1, Thermofisher 32-0500 ...
-
bioRxiv - Molecular Biology 2020Quote: ... except for a shorter blocking step of magnetic beads used for immunoprecipitation: Dynabeads™ Protein A (Invitrogen™) were blocked by washing three times for 5 minutes each ...